KEGG   Erythrobacter gangjinensis: BMF35_b0024Help
Entry
BMF35_b0024       CDS       T04581                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
egn  Erythrobacter gangjinensis
Brite
KEGG Orthology (KO) [BR:egn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMF35_b0024
Enzymes [BR:egn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BMF35_b0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_7 Spermine_synth NAD_binding_8 FAD_binding_3 FMO-like DUF1694
Motif
Other DBs
NCBI-ProteinID: APE29279
UniProt: A0A0G9MKC2
LinkDB All DBs
Position
II:complement(23175..24767)
Genome map
AA seq 530 aa AA seqDB search
MLDQTMTDQLRTYLGNLREPVTLVASLDDGEKSAQTRELLEEIAALSDLVTASFDGDDAR
RPSFLIRRGDDDARAVRFAGLPMGHEFTSLVLALLWAGGHPPKVEQDVLDQIAALEGEHD
FEMYFSLSCHNCPDVVQALTLMALTNPRITATLIEGGTFKDEVERREVMAVPATYRNGEV
FYNGKMSLEEVLAMLDTGAADKAAEKLSAKKPFEVLIVGGGPAGVASAIYTARKGFRTGI
AAERFGGQLNDTLGIENLPGTAYTEGPKLASELDGQVKAHAEIDMMNLAAAEKLVPAEKA
GGMHELHLANGAVLKARSLILATGARWRELGVPGEQEYRNKGVAYCPHCDGPLFKGKRVA
VIGGGNSGVEAAIDLANIVGHVTLIEYDSQLRADQVLQDKLRRMSNVDIITSARTTEVTG
DGGKVSGLSYEDRESGEVRELPMEGVFIQIGLVPNTEWLAESGIALSQHGEIEVDGHGAT
NLPGIFAAGDCTIVPYKQIVVAMGAGSKAALSAFDYLIRNETAEDIAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccagacgatgacagaccagctgcgcacctatctcggcaatctgcgcgagccg
gtgacgcttgtcgcctcgctggacgatggggagaaatccgcccagacgcgcgagttgctg
gaagagatcgccgcattgtcggacctggtgacagccagcttcgatggcgacgatgcgcgc
aggcccagcttcctgatccgccgcggtgacgacgatgcgcgcgcggtgcgcttcgccggt
ctgccgatgggccacgaattcacctcgctggtgctggccctgctgtgggcgggcggtcat
ccgcccaaggtagagcaggatgttctcgaccagatcgctgcgcttgaaggcgagcacgat
ttcgagatgtatttctcgctctcctgccacaattgcccggacgtggtgcaggcgctcacg
ctgatggcgctgaccaatccgcgcatcactgccacgctgatcgaaggcggcaccttcaag
gacgaggtcgagcgccgcgaggtgatggccgtgcccgccacctatcggaacggcgaggtg
ttctataacggcaagatgagcctcgaagaggttctcgcaatgctcgacaccggcgccgcc
gacaaggcagctgaaaagctttccgccaagaagcccttcgaagtgctgatcgtgggcggc
ggtccggcaggcgttgcgtccgccatttacacagcgcgcaagggctttcgcacgggcatc
gcggcagaacgcttcggcggacagctgaacgatacgctgggcatcgagaacctgccgggc
actgcctataccgaaggcccgaagctggccagcgaactggacggtcaggtgaaagcgcat
gccgaaatcgacatgatgaacctcgccgctgccgaaaagctggtgcctgcggaaaaggcc
ggcgggatgcatgaattgcacctcgccaatggcgccgtgctgaaagcgcgcagcctcatc
ctcgccaccggcgcgcgctggcgcgaactgggcgtgccgggagagcaggagtatcgcaac
aagggcgtcgcctattgcccgcattgcgatgggccgcttttcaagggcaagcgcgtggcc
gtgatcggcggtggcaatagcggcgtggaagccgcgatcgaccttgccaatatcgtcggc
catgtgacccttatcgaatatgacagccagctgcgcgccgaccaggtgctgcaggacaag
ctgcgccgcatgagcaatgtcgatattatcaccagtgccaggacgaccgaggtcaccggc
gatggcggcaaggtgtccggcctttcctacgaagatcgcgagagcggcgaggtgcgtgaa
ctgcccatggaaggcgtgttcatccagatcggcctcgtgcccaatacagaatggttggcc
gaaagcggcatcgcgctttcgcagcacggtgagatcgaagtggatggccatggcgcgacc
aatctgccgggcattttcgccgcaggcgattgcactatcgtgccgtacaagcagatcgtg
gtcgccatgggcgcaggctccaaagccgcactgtcggctttcgactacctcatccgcaac
gaaacggcagaggatatcgcgcaggctgcgtga

DBGET integrated database retrieval system