KEGG   Elizabethkingia ursingii: BBD34_16950Help
Entry
BBD34_16950       CDS       T05036                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ego  Elizabethkingia ursingii
Brite
Enzymes [BR:ego01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BBD34_16950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AQX10217
UniProt: A0A1T3FTC0
LinkDB All DBs
Position
3727566..3728246
Genome map
AA seq 226 aa AA seqDB search
MKLFGAATLGFVLVAQLVSAQFKQAPLPYAYNALEGSIDAQTMEIHYSKHGAAYVANLNK
AITGTPLEKESLVKILSGISKQTPAIRNNAGGHYNHELFWTILTPEKNTQLSEKLAKAIN
QSFGSFDAFKEKMGKAGADRFGSGWAWLIVTPDKKLAVTSTANQDNPLMDIAEVKGIPVL
GIDVWEHAYYLKYQNKRADYLSAIWNVINWKEINKRYEAALSGKTE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttggagcagccactctaggctttgtacttgtggcacagctggtatcagca
caatttaagcaagcaccgttaccttatgcttataatgcattggaagggtcaatcgatgcg
caaacaatggaaatacattacagcaagcatggtgcagcgtatgtagcaaatttaaataag
gctatcaccgggacgccattggaaaaggaaagtcttgtgaaaatactttccggaatctcg
aaacagactccggcaataagaaataatgctggtggtcactataaccacgagttattctgg
acaatcctaacacctgaaaagaatacacaactgtctgaaaaactagcgaaagccattaat
cagtcttttggaagttttgatgcttttaaagaaaagatgggcaaagccggagcagatcgt
tttggttcaggttgggcatggcttattgtaacaccggataagaagttagcagttacttct
actgcaaatcaggataatccactaatggatattgctgaggttaagggaatacctgtacta
ggaattgatgtatgggaacatgcttactatcttaagtatcagaataaaagagctgactac
ttaagtgcaatatggaatgtaatcaactggaaagagattaataagagatatgaagctgct
ttaagtggcaaaactgagtaa

DBGET integrated database retrieval system