KEGG   Elizabethkingia ursingii: BBD34_18005Help
Entry
BBD34_18005       CDS       T05036                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ego  Elizabethkingia ursingii
Pathway
ego00020  Citrate cycle (TCA cycle)
ego00310  Lysine degradation
ego00380  Tryptophan metabolism
ego01100  Metabolic pathways
ego01110  Biosynthesis of secondary metabolites
ego01120  Microbial metabolism in diverse environments
ego01130  Biosynthesis of antibiotics
ego01200  Carbon metabolism
Module
ego_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ego_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ego00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD34_18005
  Amino acid metabolism
   00310 Lysine degradation
    BBD34_18005
   00380 Tryptophan metabolism
    BBD34_18005
Enzymes [BR:ego01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BBD34_18005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AQX10409
UniProt: A0A1T3FMP4
LinkDB All DBs
Position
3963752..3966559
Genome map
AA seq 935 aa AA seqDB search
MDRFSFLNAVHSQFIEDMYQQYLKYPDSLEPSWKAFFQGFDFALENYSDEEAVQEIKSFA
SQAENSNVNISEISEDIRREFKVINLIEAYRVRGHLFTKTNPVRERRHFEPTLDIENFGL
TSADLNRKFNSATETGMPGPATLSEIIRHLQSIYCDSIGVEYMYIKNVEERDFIRQWLQA
NENHAKLSPEEKKHVLQRLNQAVAFESYLHTKFVGQKRFSLEGLESLIPALDQVITKSSQ
LGVDEVVLGMAHRGRLNVLTNIFQKPYKQIFSEFEGKEFEEDVFSGDVKYHLGASKVIQT
TAGETVKINLTPNPSHLETVASLVEGISRAKVDNSYNGDYNKILPIVIHGDAAIAGQGIV
YEIAQMMTLDGYKTGGTIHIVTNNQVGFTTNYLDARSSTYCTDVAKVTDSPVMHINADDV
EAVVHAMHFAADFRNRFGKDVYIDLLGYRKYGHNEGDEPKFTQPKLYNIIAKHPNPREIY
KDKLIKEGIVSDDVMKQMEVEFKKLLDENFDESKEIKKNTMDIFMADDWKKFPFGSRGSV
LNPVDTKFPLDKLKDLARQISTLPTDKKFIKKITRLFEQRLNMVENDNLDWAMGELLAYA
TLLSEEFGIRISGEDVERGTFSHRHAVVKTEDTEEEYVPLKSVTTKDNQFQIYNSLLSEY
AVLGFDYGYAMVSPDTLTIWEAQFGDFANGAQIIIDQYLVAAEEKWKLQNGLVMLLPHGS
EGQGAEHSSARLERFLTLCANQNIIVANATTPANYFHLLRRQMKADFRKPLVVMTPKSLL
RHPRAVSKVEELANGAFQPIIDDATAKADKVERLVLCSGKLYYELLAKKEELNDEKVALV
RLEQLYPLQMDQLDAIFEKYSNAKEFIWAQEEPENMGAWSYILRNLRDRNPQVISPVASG
APAPGSHKKFEINQNAIINQVFQCDGTPAKRPVTA
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcattcttaaatgcggtacattctcagtttatagaggatatgtaccag
cagtatttgaaatatcctgacagtctcgaaccatcatggaaagctttttttcaggggttt
gatttcgctttggaaaactacagtgatgaagaagcagtacaagaaattaaatcttttgca
tcacaggcagagaacagcaatgtcaatatttcagaaatttccgaagacattcgcagagaa
ttcaaagtaattaatcttatcgaggcataccgtgttcgtggtcaccttttcactaaaacc
aatccggttagagagagaagacacttcgagccaaccttggatattgaaaattttggactg
acttctgctgatttaaatagaaaattcaacagcgctacagaaaccggaatgccgggacct
gcaacgcttagtgaaataataagacatcttcagagtatctactgcgattctatcggagta
gaatacatgtacattaaaaatgttgaagaaagagatttcattcgtcagtggcttcaggca
aatgaaaaccacgcaaaactttctcctgaagagaaaaagcatgttttacagagacttaat
caggcagtagcttttgagagctacctgcatacaaaattcgtaggacagaagcgtttctca
ttagaaggtttggaatctttaatccctgcgttggatcaggttattactaagtcttcacaa
ttaggtgttgatgaagtagtattgggtatggcacacagaggaagactgaatgtgttaaca
aacattttccaaaagccttacaagcaaattttcagtgaattcgaaggtaaagaatttgaa
gaagatgtattctctggtgacgttaaatatcacttaggagcatctaaagttattcagaca
actgccggagaaactgtaaaaattaatcttacaccgaatccgtctcacctggaaacagtt
gcttcattagtagaaggtatcagccgtgctaaagtagacaacagctacaacggagattat
aataagattttaccaatcgttattcatggtgacgctgcaattgccggacagggaattgta
tacgaaattgcacagatgatgacgctggacggatataaaacaggaggtacaatccacatc
gttacaaataaccaggtaggatttacaaccaattatttagatgcacgttcatctacttac
tgtacagatgtagcgaaagtaactgattctccggtaatgcatattaatgcagacgatgta
gaagcagttgttcacgcaatgcattttgctgcagacttccgtaacagatttggtaaagat
gtttatattgatcttttaggatatagaaaatatggccacaacgaaggtgatgaacctaag
tttacacagcctaaattatacaacatcattgcaaaacaccctaaccctagagaaatttat
aaagataaattaatcaaggaaggtattgtttctgacgacgtgatgaagcaaatggaagtt
gaattcaaaaaattattggatgaaaacttcgacgaatctaaagaaattaagaagaatacc
atggatatcttcatggcagacgattggaagaaattcccgtttggatccagaggatcagtt
cttaatcctgtagatactaaattcccattagataaacttaaagatttagcaagacagatt
tctacactgcctacagataagaaatttatcaaaaaaatcacaagattattcgagcagaga
cttaatatggttgagaacgataatcttgactgggcaatgggtgagcttttagcttatgct
acattgctaagtgaagagtttggtatcagaatttctggtgaagatgtagaaagaggtact
ttctctcaccgtcatgcagttgtaaaaactgaagatacagaggaagaatatgtaccatta
aaatctgttactactaaagataaccagttccagatctataactcattactttctgagtat
gcagttttaggattcgattacggatatgcaatggtgtctccggatacccttacaatctgg
gaagctcagtttggtgatttcgctaacggagcacagattattatcgaccagtatcttgta
gcagctgaggaaaaatggaaactgcaaaacggattggtaatgttattgcctcatggttct
gaaggacaaggtgctgaacactcttctgcaagattagagcgtttccttacactttgtgca
aaccagaatattattgtcgctaatgctacaacaccagctaactacttccacttgttgaga
aggcaaatgaaagctgatttcagaaaaccattagtagtaatgactccaaaatcattattg
cgtcatccaagagctgtttctaaagttgaagaattggcaaacggagcattccagccaata
attgatgatgctacagctaaggctgataaagtagaaagattagtattatgttcaggtaaa
ttgtattatgaactattagctaaaaaagaagaactgaatgatgagaaagttgctttggta
agactagagcagttatatcctcttcaaatggatcagttggatgctattttcgaaaagtat
tctaatgctaaagaattcatctgggcacaggaagagcctgaaaacatgggcgcatggagc
tatatcctgagaaacctaagagacagaaatcctcaggtaatttccccggtagcaagtggg
gcacctgcaccgggttctcataagaaattcgagatcaaccagaatgcaattatcaatcag
gtatttcagtgtgatggaacacctgcaaaaagaccagtaacagcttaa

DBGET integrated database retrieval system