KEGG   Eucalyptus grandis (rose gum): 104414021Help
Entry
104414021         CDS       T03547                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dnaJ protein ERDJ2A-like
  KO
K09540  translocation protein SEC63
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr03060  Protein export
egr04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:egr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    104414021
   04141 Protein processing in endoplasmic reticulum
    104414021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:egr03110]
    104414021
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:egr02044]
    104414021
Chaperones and folding catalysts [BR:egr03110]
 Heat shock proteins
  HSP40 / DNAJ
   104414021
Secretion system [BR:egr02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   104414021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ ECF_trnsprt
Motif
Other DBs
NCBI-GeneID: 104414021
NCBI-ProteinID: XP_010044367
LinkDB All DBs
Position
Unknown
AA seq 681 aa AA seqDB search
MAASEENSALFPIFILTIMALPLVPYTVMKLCHAATKKSKITHCQCSECLRSGKYRRSIF
KRISTFSTCSNLTLVLLWIVMIFLVYYIKNMSGEIQVFEPFSILGLEAGASDSEIKKAYR
RLSIQYHPDKNPDPEAHNYFVEYISKAYQALTDPISKENFEKYGHPDGKQGFQMGIALPQ
FLLDIDGASGGILLLWIVGVCILLPLVIAVIYLSRSSKYTGNYVMHHTLSNYYRLMKPSL
APSKVMEVFIKAAEFMEIPVRRTDEEPLQKLFLLVRSELNLDLKNIKQEQAKFWKQHPPF
VKTELLIQAQLTRESDSLSPALVGDFRRVLELTPRLLEELMKMAVIPRTAQGHGWLRPAI
GVVELSQCIIQAVPLSAKKTTGGSSEGIAPFLQLPHISESVIKRIARKKVRTFQELRDMS
LEDRAELLQXSSLSSTEVQDIERVLEMMPSLSIDITCETEGEEGIQEGDVVTIQAWVTLK
RDNGLVGALPHAPRYPFHKEESFWFLLADPNSNDVWFSQKLSFMDEAAAVSAASKAIEET
MEGLGADAKEKSKAVREAVEKVRSGSRLVMGKFLAPVEGNYNLMCYCLCDSWIGCDKKVN
SKVKVLKRTRAGTRGGAALEESIVEDGIEEEEESDEEEYDYESEYSEDEADEQDSKKKGK
TANGTVPKKGSSSEGSGTDED
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcggaggagaatagtgcgttgtttcctattttcattttgactataatggcg
ctgcctttggtgccttataccgttatgaagttatgccatgctgctaccaagaaatcaaag
atcacgcactgccagtgttcggaatgcttgcgatcagggaagtatcgcaggtctatattc
aagaggatctctacattttcaacatgcagcaacctgacattagtactgctctggatcgtc
atgatatttctagtgtactacatcaaaaatatgagcggggagattcaagtttttgagcct
tttagcattcttgggttagaagctggagcttccgattcagaaataaagaaggcctataga
agactttcaattcaataccatcctgataagaatcctgatccagaggcacacaattatttc
gtggagtacatttccaaggcttatcaagctctcactgatcctatatctaaggaaaatttt
gaaaaatatggccatccggacgggaagcagggatttcaaatgggtattgctctccctcag
tttctgctggatattgatggtgcttctggtggaattcttctactttggattgtgggcgtc
tgtattcttttgcctctagttattgctgtgatatacctctcaaggtcatcaaagtatact
ggaaactatgtcatgcatcataccctgtccaattactatcgcttaatgaaaccgtctttg
gcaccgagcaaagttatggaggtctttatcaaggctgctgaattcatggaaattccagtc
cgaaggactgatgaggaaccccttcaaaagctgtttttattggtcaggagtgagttgaat
ctggatctcaagaacatcaagcaagaacaagctaagttttggaagcaacatcccccattc
gttaagacagaattgttgattcaggctcagttaacaagagaatcagattccttgtctcca
gctttggtcggtgatttcagacgtgttttggaacttacacctcggctacttgaagaatta
atgaagatggctgtcattcctcgcactgcccaaggacatggttggctgaggcctgcaatt
ggggttgtggagctttctcaatgcattattcaggctgttcctctcagtgcaaagaagaca
accggaggatccagtgaaggcattgcaccttttctgcagctgccgcatatcagtgaatct
gttattaagaggattgctcgcaagaaagtgagaacatttcaggagctccgggacatgtct
cttgaggaccgtgccgaactcctccagngcagcagcctctccagcacagaagtacaagac
atagagagagttctggagatgatgccttctctatcaatagacattacatgtgagactgaa
ggtgaagaaggtatacaagagggtgatgtggtcacgattcaggcttgggttacactcaaa
agagataatggactcgtcggcgccctacctcacgcaccgcggtatcctttccacaaagaa
gaaagtttctggtttcttctggcagaccccaactccaatgacgtttggttttctcagaag
ttaagtttcatggatgaagcagccgctgtaagtgctgcctctaaggcaattgaggagact
atggagggattgggagcagatgcaaaggaaaaaagtaaggccgtcagagaagcggtggag
aaggtgaggagtggctcgaggttggtcatgggcaagtttttggcccccgtggaagggaac
tacaatttgatgtgttactgcttgtgtgattcgtggattggttgcgacaaaaaagtgaac
tcaaaggtcaaagttctcaaaaggactcgtgcaggcaccaggggcggcgctgcactggaa
gagtccatagtggaggacgggatcgaagaggaagaggagagtgatgaagaggagtatgat
tatgagagcgagtacagcgaagatgaggctgacgagcaggactcgaaaaagaaaggcaag
actgctaatggcacggtgcctaagaagggttcgagttcggaaggctcggggacagatgag
gactga

DBGET integrated database retrieval system