KEGG   Eucalyptus grandis (rose gum): 104415501Help
Entry
104415501         CDS       T03547                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:egr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104415501
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104415501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104415501
NCBI-ProteinID: XP_010025114
UniProt: A0A059B660
LinkDB All DBs
Position
Un
AA seq 152 aa AA seqDB search
MVKAVAVLGSSEGVTGTVHFVQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPVGKEHGAPEDENRHAGDLGNVTVGDNGTATFTITDKQIPLTGPNSIVGRAVVVHS
DPDDLGKGGHELSKTTGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgttgccgtactcggaagcagcgagggtgtcactggcaccgtccacttc
gtccaagaaggagatggcccgaccacagtgaccggaagtctttctggcctgaagcccggg
cttcatggtttccatgttcatgcccttggggacaccacaaatggctgcatgtcaactgga
ccacatttcaatcctgtcggtaaggagcatggtgcccctgaagacgagaatcgtcatgct
ggtgatttgggaaatgtgactgttggtgataatggtactgctactttcaccattactgac
aagcagattcctctcactggacctaattcaattgttggaagggctgtggttgtccattca
gatcctgatgatcttggcaagggtggacatgagcttagcaaaaccactggaaatgctggt
ggcagagttgcttgcggtatcatcggtcttcagggatga

DBGET integrated database retrieval system