KEGG   Eucalyptus grandis (rose gum): 104418507Help
Entry
104418507         CDS       T03547                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00010  Glycolysis / Gluconeogenesis
egr00053  Ascorbate and aldarate metabolism
egr00071  Fatty acid degradation
egr00280  Valine, leucine and isoleucine degradation
egr00310  Lysine degradation
egr00330  Arginine and proline metabolism
egr00340  Histidine metabolism
egr00380  Tryptophan metabolism
egr00410  beta-Alanine metabolism
egr00561  Glycerolipid metabolism
egr00620  Pyruvate metabolism
egr00903  Limonene and pinene degradation
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104418507
   00053 Ascorbate and aldarate metabolism
    104418507
   00620 Pyruvate metabolism
    104418507
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104418507
   00561 Glycerolipid metabolism
    104418507
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104418507
   00310 Lysine degradation
    104418507
   00330 Arginine and proline metabolism
    104418507
   00340 Histidine metabolism
    104418507
   00380 Tryptophan metabolism
    104418507
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104418507
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    104418507
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104418507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 104418507
NCBI-ProteinID: XP_010028184
UniProt: A0A059CZ25
LinkDB All DBs
Position
Unknown
AA seq 534 aa AA seqDB search
MAARRLSSLLTRSLSASRLLSSGRNHGVGSSISRYSTAAAVEELISPPVQISYTQHLING
HFVDAASGRTFPTYDPRTGDVLAHVAEGDAKDIDRAVAAARKAFDEGPWPKMTAYERSRI
LLRFADLVEKHNDELAALETWNCGKPYEQSAKSELPMLARLFRYYAGWADKIHGLTVPAD
GNYHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKTAEQTPLTALYAAKL
FQEAGLPPGVLNVVSGYGPTAGAALASHMNVDKIAFTGSTETGKVVLELAARSNLKPVTL
ELGGKSPFIICEDADVDKAVELAHFALFFNQGQCCCAGSRTYVHERVYDEFVEKAKARAL
KRSVGDPFKKGIEQGPQIDVEQFQKVLRYIRAGIDSNATLECGGDRLGSKGFFVQPTVFS
NVQDDMLIAKDEIFGPVQSILKFKDLDEVVRRANSTRYGLAAGVFTKDIDVANALSRALR
VGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgcagattgtcttccttgctgactcgttcgctctctgcttcgcggctcctg
tcttcaggaaggaaccatggcgtgggaagtagcatcagcaggtacagcaccgcagccgca
gtcgaagagctgatttcgccgcccgtccaaataagttacacacagcatctgattaatggg
cacttcgtggatgcggcctcaggaagaactttcccaacgtatgatcctcgtactggggat
gtccttgctcatgtcgctgagggtgatgccaaagatattgaccgcgctgtggcggctgct
cgcaaggcattcgatgagggaccgtggccaaagatgactgcttacgaaagatcaaggata
ctgctgcgcttcgccgatttggttgaaaagcataatgatgagcttgcagctctggagaca
tggaattgtggaaagccttatgagcagtctgccaaatctgaattgccaatgctggcacgt
ctgtttcggtattatgctggttgggctgataaaatccatgggctgacagtcccggccgat
ggaaattaccatgtgcaaacattgcatgaaccaattggtgttgcggggcagatcattccg
tggaactttcctctcattatgttcgcttggaaagtcggacctgcattggcatgtggtaac
acaattgtcctaaagacagcagaacaaacacctttgacggcactgtatgctgcaaaactc
ttccaggaggctggccttcctcctggtgttctaaatgttgtttctggctatggtcctaca
gctggtgcggctcttgcaagccatatgaatgtggacaagatcgccttcactggatcgacc
gaaactggcaaggttgtcctggaattggctgcaaggagcaatctgaagcctgtgacattg
gaactaggaggcaaatcgcctttcataatctgtgaggatgctgatgttgataaagccgtg
gagcttgcacactttgctcttttctttaatcaggggcaatgctgctgtgctgggtctcgt
acatatgtgcatgaacgagtgtacgacgagttcgtagagaaggcaaaagctcgggcactg
aaacgtagtgtcggagatcctttcaagaagggtatcgaacaaggtcctcagattgatgtg
gagcaattccagaaggtgcttagatacataagagctggaatagatagcaacgcgactctt
gaatgtggaggcgatagattaggctccaaaggtttctttgttcagccaacagttttctcg
aatgtccaggatgatatgctgatagcaaaggatgagatcttcggccctgtgcaatcgata
ttgaaattcaaggacctcgacgaagttgtccgaagggccaacagcacacgttatggtcta
gctgcaggcgttttcactaaggacatagacgtagcgaacgcgctatcacgggcgttgagg
gtcgggaccgtgtggatcaactgcttcgacgtctttgacgcagcgattccgttcggtggt
tacaagatgagcgggataggacgggagaaggggatctacagcctcaataactatctgcaa
gtcaaggccgtagttacgcccctgaagaatccggcttggctgtaa

DBGET integrated database retrieval system