KEGG   Eucalyptus grandis (rose gum): 104418508Help
Entry
104418508         CDS       T03547                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00562  Inositol phosphate metabolism
egr01100  Metabolic pathways
egr04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104418508
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    104418508
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egr01009]
    104418508
Enzymes [BR:egr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104418508
    3.1.3.48  protein-tyrosine-phosphatase
     104418508
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104418508
Protein phosphatases and associated proteins [BR:egr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104418508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 104418508
NCBI-ProteinID: XP_010028180
UniProt: A0A059AN87
LinkDB All DBs
Position
Unknown
AA seq 610 aa AA seqDB search
MDAQPVDSSSQSPSTSSEDKPTVPSISQTGTPSHELPSFLSASGISSWTRNLKLPQPLAT
SKDSSQSPNSGIGTLSRFANGMGFRLPAGTPTKEADQGTSENAQSGGLGSVAKGLLDSSR
NAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENVIAMGFPAGDISSGLFGYFEGFYR
NHMEEVINFFETHHQGKYKVYNLCSERLYDASLFGGKVATFPFVDHNCPPMPLILSFCQS
ASSWLKEDIENVVAVHCKAGMGRTGLMICSLLLFMKIFPTADEAVAYYNQKRCIDGKALV
LPSQIRYVQYFERVLTGFSREIPAGRRCMLRGFRLHRCPSWIRPAITISDHNGVLFSSKK
HPKTKDLMPQDFWIKPPKKGVVVFAIPGEPGLTELKGDFKIHFHEYQGDFYCWLNTTMME
NRTLLTSSDLDGFDKRNVPSPGFHVEVVMIDYDGTMPAKANTDSTGKEPDSMSRSSDPNG
RATSKSTDTKASQKNDNDDDVFSDSEGEETRPSNNKQVRRGDEPTLVPDTGSSSVKQMET
LTQSADKLSLGSEQHSQGYANKEVHSDGAEKTASGLEMPKPDSGGVSDFKAIAADASVFT
FGDEEDYESE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggatgcccaaccagtggactcatcatctcaatctccttccacttcttctgaagataaa
cccaccgtccctagcatttctcagacagggaccccttcccatgaattgccatctttctta
tctgcctctggcatatcatcttggacaagaaatttgaaacttccgcagcctctagcaact
tcaaaggacagttcacagagtccaaattcagggattgggacactatcaagatttgccaat
ggcatgggatttcgattacccgcaggaactccaacaaaagaggctgatcaaggcacctca
gaaaatgctcaatctggtggcctcggatcagtggcaaaagggttgcttgactcatctcgc
aatgctgtgaaggctgtgcaggtcaaggcacgtcatgttgtctcacaaaataagaggaga
taccaggaaggaggatttgatttggatatgacatatatcactgagaatgtaattgcaatg
ggattcccagctggagatataagctcaggtctatttgggtattttgagggcttttatcgt
aatcatatggaagaggtgattaatttttttgagacgcaccaccagggaaaatacaaagtc
tataatctctgttcagaaaggctatatgatgcatcactttttggtggaaaggttgcgact
tttccatttgttgatcacaattgcccacctatgccacttatactatccttttgtcaaagt
gcatcctcatggttgaaggaggacatagaaaatgttgtggcagttcactgtaaagctggg
atgggtaggacggggttgatgatctgcagcctgctcttgttcatgaagatcttccctaca
gctgatgaggccgttgcttactacaatcagaaaagatgtatagatggcaaggctctagtt
cttccaagtcaaattaggtatgtccagtactttgagcgtgttttaaccggcttcagtaga
gaaattccagctggacgtagatgcatgcttagaggattccggcttcacagatgtccctct
tggataaggccagcgattacgatatctgatcataatggtgttctcttctcctccaaaaag
catcccaagactaaagatctaatgccacaagatttctggatcaaaccacccaagaaggga
gtggtcgtttttgctataccaggagagcctggccttacagagttgaagggggactttaaa
atccactttcatgagtaccaaggagatttttactgttggttaaatacgacaatgatggaa
aacagaacacttctaacctcatctgatcttgatggctttgacaagagaaatgttccttct
cctggattccacgtggaagttgtaatgatagattatgatggcaccatgccagcaaaggcc
aatactgactccactggcaaggagcctgattcaatgtcaagaagttcagatccaaatggc
agagccacaagcaaatcaaccgacacaaaggcatctcaaaaaaatgacaacgatgatgat
gttttctctgacagtgaaggagaggagacccgtccctcaaataacaagcaagtacggcgt
ggtgatgagccgactcttgttcctgataccgggagttcatcagtgaagcaaatggagacc
ttgacgcaaagtgctgataagctgtcactaggcagtgagcaacattcacagggttacgct
aataaggaagtgcatagtgatggagctgagaaaactgcttctggcctggagatgcctaag
cctgactctggtggagtcagtgactttaaagccatagcagctgatgcctcggtttttaca
ttcggagatgaagaagattatgaaagcgaatga

DBGET integrated database retrieval system