KEGG   Eucalyptus grandis (rose gum): 104418769Help
Entry
104418769         CDS       T03547                                 

Definition
(RefSeq) kinesin-like protein KIN-12D
  KO
K10400  kinesin family member 15
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:egr04812]
    104418769
Cytoskeleton proteins [BR:egr04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     104418769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd GAS HMMR_C
Motif
Other DBs
NCBI-GeneID: 104418769
NCBI-ProteinID: XP_010028514
LinkDB All DBs
Position
Unknown
AA seq 3016 aa AA seqDB search
MLRDLKFLRRNSGKHEEVENLPLQPTSSSAVQAAWDSSRAPLNAIQEPTQNPRPEAEVSA
KGRVDRTPGKPKVRNADPPLPLRTPEKHNLGLSSKNRFGWAKNEGGSVTADANDDSRTDE
KYFSTQISRGIGVGNFATPRTTRTVGRANSNYSESTSTQSTPTKSVNKPPSVGLRGKMDG
NGGGRWGNFAALYKGIPSSIGPTTVVNTVEVPHFDLKEDPSFWMEHNVQVLIRVRPLNNM
ERSTYGYNRCLKQESSQSITWIGQPETRFTFDHVACETVDQEMLFRMVGLPMVENCLSGY
NSCMFAYGQTGSGKTYTMLGEIEDLELKPSPHRGMTPRIFEFLFARIQAEEESRRDEKLT
YNCKCSFLEIYNEQIMDLLDPSSTNLSLREDVKNGVYVENLSEFEVRTVTDILKLLAEGS
SNRKVAATNMNRESSRSHCVFTCVIESRWEKDSTANLRFARLNLVDLAGSERQKTSGAEG
DRLKEAANINKSLSTLGHVIMVLVDVANGKPRHIPYRDSRLSFLLQDSLGGNSKTIIIAN
ISPSISSSAETLNTLKFAQRAKLIQNNAVVNEDSTGDVIVLQNQIRLLKEELAALKRHNI
SRSLSFGSTSIVGAGDKSDGDKQEVDNSLHFDPSGVVRMSNKQLKSLETTLAGALRREQM
AELTIRQLEAEIEQLNRLVRQREEDTRCTKMMLRFREDKIQRMESLHIGSITAEVYLHEE
NKTLSEEIQLLQAKVDRNPEVTRFALENIRLLDQLRRFQEFYEEGERELLLAEVTKLRDQ
LLQFMDGNSEQPNHLSSGIQPQEAMQAGKEHATLQLELRNTSKELEECRRNLTSCLEENA
KLSREIHHLSCKLDSLNSQDDNGDGNSKKDLRDECSQGPQWKHTILGNERAEEIMDLQLE
LDIFKIILKEERTSRGELEERIICLDKDLELAMEKLLSTSKRCEDVTSELKEAKSVIEAL
ESQQILSLNEMEDLQSSNSNYMKLLSLKKIEIVALKKQLSSKRFRDQEPSNGAGSEDSPM
QARLKKMQDSLEKAKQLNMWYQNDHAFQESNEEEMDKVRKQAEAETAEVIVCLEEELTIL
QQQVLDSQVREMETKQSTAMLQTELKDLQEKLDLVTENNTQLIGLLEDRDRELQTLSEEW
KLLTCEIEEVLANGNESLAVASDELGYISNSFPQKRIWIAEHFSQMIRTISEKDLMIEEL
SKYLEDANKKRNDLDCMLKSLRGATLAITEAHQQECSEKEREIVLLTSQLEATAHELCKL
EERAKFAEDAIKNASTMATAAFVVVNRFSEVNHNYLTELEQKDIFLRESADMNMKKDIFL
SEQAATIEESKKQIDSLRKDLVHLENACTELRKERLEEQQHLFVMEQKLEQMEESHIMKA
RDKLDELKTGVSMLRSCMSDYLEHDESPQGTDEQLFYASSSNKVERPINSETSTENSLNL
RAVKGPSGDDTSCSFLVGNTMPPHSYARDITISLLRKEIECALESLKQVQTEMAQLYKEK
EERLLSEERGRDRTKWLTNQLLSLEGVMRNFEEQSQLKIEALNLKMQTVSQTVKSASTDW
CKTKELLECEVGEAEIVAAQKSAEASLILAKFEEAQDTLKEADIIINELVMANEVMKLDI
GKLEKNVGSLMNERDMLLNEVQNLQSISSQKCEQIDSLEEHISLHMAETRDMLAGLQGIA
GEFQSTFEEQFSSLANDFNSMKFQVSNSTKLVKSWLEDIWSEIIVRDCAVSSLHLCHIGI
MLETVTGLNAENGLLQHGLHQKNSLLTDLREHNLKSKKELEVFRILKGKLLADIKNSFDR
ISRKEEEAGDMRNKVTGFEKKILDLQYQEELMLERSNHMGSQLAILMKELDWTNSNAINS
LLEQEKLMRAEEEALHSKLELLTLDSCSKDLMLLILQKEIEEIALQKANLNSKNVNSFAA
LQNLTREIIISKVDGELKEQVLLDNEIQISLLKKEVEEAESNRLDLSTKLGESNSRILQM
DGVTRALEQDLQLLKEVDHANSLLKAELSETKTTESRLLNQIESLEADREKIAENLRTKE
TALDCSSNQMSSLDQHNQKLQGDVCSLKASLQVFQNELDQKNQELSRMVGLSEAYELLNM
EMSKLKNEKTLVLQDLAKTKSECKSSLSGIDTFSKENIRLNDQIILLETNIVSLKTDLEE
KNAQLHEIQHSRSSLLEDLSLKGEELQRYTYSLSNLENENKLLRNKLQVTEKGIELLIAS
GLESEICAELVNTIDISNGRLYDEIAGSAFKSMGNMLEQTHEEAEQVSKFIEQIEGFEHH
VKELMSENSTLRTELLRKDDILKGLLFDLSLLQESASNTIDQKDEIEEMTADLESLENEL
AGKVDELDEAIAHSQKLEAELQEKVHAISILELDISKECEKADSLSKENLDLKACLQKAL
AEKGSAEEDLVERSKEIESLEMELSAMGNAIDQMNDSMEYLKSNLDELNFERDQFQAEVL
TLQEKLEKAWATAHKNEAVAIEAKRRAEERETYALDKEEEVKLLERSVEELEHTINVLEN
KVDIVKGEAERQRLLREELELELHSIKSQMQNVQNADADIKRHLDEKKADLEKSLKQVQM
LEREIAEKDAENVQLKAHITELNLHAEAQASEYKQKFKALEAMADQVKPEGSFTQNANQL
SYKSEKNTPRPRGSGSPFKCIGLGLAQQVKSENVEELTAAKLQIAELESLVVSKQKEIFS
LNAKLAGAESMTHDVIRDLLGVKLDMTSYASLWHNQQVEKVNEKPLLQKSESQSEDQEVM
KLKKELDEFVDERKGWLEEIDRRQAELVAAQIALEKHRQQEQLLSTEKEVLKTENVKCKK
KITELQDESLKLSGQQNLQQRIHHHAKIKEENNMLKTQNEELATKLRRAEVILSRVKEEL
ARHRASAGKAPYINFDEEQRWNDKFKEAEEEKLQLAQKLLGLCTRILKVAGFRKPHSEIC
PSVAEEALEQLKDRITSMESELHDLKIKNRIDNERARLSELVPQQEEHSPRNRRPDETYR
SSRRASRTPFLSTLDR
NT seq 9051 nt NT seq  +upstreamnt  +downstreamnt
atgttgagagatttgaagttcctccgtcggaattccggcaagcacgaggaagtcgagaat
ttacccttacagcctactagttcatccgcagttcaagccgcttgggactcctcccgggcg
ccgttaaacgctattcaagaacctacccaaaaccctagacctgaggcagaagtcagcgct
aaaggcagggttgatagaaccccaggtaagcccaaggtcagaaatgcagatcccccgttg
cctcttcgaaccccggaaaagcataacttgggtctttcatccaagaaccggttcgggtgg
gccaaaaatgagggcggttcggttaccgcagacgcgaatgatgattccaggactgacgaa
aagtacttttcgactcaaattagtcgggggatcggtgtaggaaattttgcgactccgagg
acgactaggacggtcggaagagcgaattcaaattactccgagagtacttccacgcaaagt
acaccgactaagagtgtcaacaagcctcccagtgttggtctccgaggcaagatggatggc
aatggtggcggccgctggggaaattttgctgcattgtacaaagggatcccaagctctatt
ggtcccacgacggtggttaacacagttgaagtgcctcacttcgacctcaaggaagatcca
tcattctggatggaacacaatgtacaggttcttatccgcgtccgtcctctcaataacatg
gaacggagcacatatggttacaacaggtgcttgaaacaagaaagttctcagagcatcact
tggattggccaacctgaaactcgatttacttttgatcacgtagcctgtgaaactgtagac
caggaaatgctctttagaatggttggtcttccaatggtggagaattgtttgtctgggtat
aacagctgcatgtttgcttatgggcagacaggaagcgggaagacttatacaatgcttggt
gagattgaagacctagaactgaagcctagtcctcatcgaggaatgacaccgcgcattttt
gagttcttgtttgcaaggattcaagctgaagaagaaagccgaagggatgagaaattaacg
tacaattgcaagtgctcgttcttagaaatttacaatgaacaaattatggatctccttgat
ccttcatctacaaatttatcgttgcgggaggatgtcaaaaacggcgtctatgtagaaaat
ctctctgaatttgaagtaaggacagtgactgacattctaaagctactggctgagggttcc
tcaaatcggaaagttgcagcaacaaatatgaatagagaaagtagccgctctcactgtgtc
ttcacatgtgtgatagagagtaggtgggaaaaagattccacagcgaacctaagatttgcg
agattaaacctggttgatcttgctggttctgagaggcagaagacatctggtgcagaagga
gatcgcctaaaggaagctgctaacatcaacaaatcactgtcaactctaggtcatgtaatt
atggttttggtcgatgtggcaaatgggaaaccgagacatattccttatagagattcaagg
ctatcctttctactccaggattctcttggcggaaactcaaaaaccatcattattgctaac
attagtccttcaataagctcctctgcagagacattgaacactttgaaatttgctcagaga
gcaaaactcatacagaataatgctgtggtgaatgaagattctactggtgatgtaatcgtt
ctgcaaaatcagatacgcctcttaaaggaggagcttgctgcacttaaacgccataacatc
tccagatctttatcatttggttcaacttccattgtgggggctggtgataaaagtgatggt
gataagcaggaggtggataattctctgcactttgatcccagcggtgttgtcagaatgtcc
aataaacagcttaaatccttggagacgacacttgctggtgctctaagaagggagcaaatg
gctgaattaaccatcaggcaacttgaagcagagattgagcagttgaaccgtttggtacga
caaagagaggaagacaccaggtgcaccaagatgatgctcaggtttagggaagacaaaatc
caaaggatggaatctctccatattggttcaatcactgcagaggtatacttgcatgaggag
aacaaaacactttctgaagagattcagttgcttcaagccaaagttgatcggaaccctgaa
gtaactcgcttcgctttggagaatataaggctcttggatcaactaaggaggttccaagag
ttctatgaagaaggggagagggaactgctactggcagaagtaactaagctgcgagatcag
ctgctgcaattcatggacggaaactctgaacagcccaaccatttgagttcaggcatccaa
cctcaggaagccatgcaggcaggcaaagaacatgctacactccaattagagttgaggaac
acgtccaaagaactggaggaatgcagacggaatctaacctcttgcctagaggaaaatgct
aagcttagcagagaaatacatcatctaagttgcaagttagatagtctcaattcccaagac
gacaatggagatggcaattccaaaaaggatttaagagacgaatgttctcaagggccacaa
tggaagcacacaattctggggaatgaacgggcggaagaaatcatggatttgcagctggag
ttggacattttcaagataattctcaaagaagagagaacatcacgaggcgaactggaggag
agaatcatctgcttggataaagatcttgagctggcaatggaaaaacttttatcaacttcc
aaaagatgcgaagatgttaccagtgaattgaaagaagcaaagtctgttattgaagctctt
gagtctcaacaaattctttccctcaatgagatggaggatcttcagagcagtaacagtaat
tatatgaaacttttgagcttgaaaaagatagaaattgtagcactaaagaagcaactttca
agcaaaaggtttagagatcaggaacccagtaatggtgcaggaagtgaggactcgcccatg
caggcaaggttgaagaagatgcaagattctcttgagaaggctaagcagctgaatatgtgg
taccagaatgaccatgcatttcaagagtctaatgaagaagaaatggataaagttcgcaag
caagctgaagctgaaactgcggaggtgattgtctgcttggaggaagaacttaccattctt
cagcagcaggttcttgatagtcaggtgagagagatggagaccaaacaaagtacagcaatg
cttcaaactgaactaaaggatctccaggaaaaacttgatcttgttactgaaaataacaca
cagctcattggtctgctcgaagacagagacagagaactccagacattgtcagaggaatgg
aaacttttgacttgtgagattgaagaagtacttgccaacgggaatgaatcacttgcagtt
gcctctgatgagctgggctacatttccaactctttccctcagaaaaggatttggattgct
gagcatttcagtcagatgattcggactatatctgagaaggatctgatgattgaagaactc
agtaaatatttagaagatgcaaacaagaaaagaaatgatttggattgcatgttgaagtct
ttgagaggagcaaccctggccattactgaagcacaccagcaggagtgtagtgaaaaagag
agagaaattgtcttgttgacctcacaattagaggcaacagcacatgaactatgcaagttg
gaggagagagctaaatttgctgaagatgccataaaaaatgcatcaactatggcaaccgct
gcttttgtagttgtgaatagattttccgaagtaaatcacaattatctcacagaattggag
caaaaagatatctttctacgtgagtcagcagatatgaacatgaagaaggatatctttctc
agcgaacaggctgcaactattgaggaatcgaagaagcagatcgactctctacgaaaggat
ctagtacatttggaaaatgcttgtacagaactaagaaaggagcgcttagaggagcaacaa
catctctttgttatggagcaaaagctagaacagatggaagagagtcatattatgaaggca
agagataaattagacgagctcaaaactggcgtatccatgctcaggtcttgcatgagtgat
tacttagagcatgatgagagtcctcaaggaactgatgaacaattattttatgcatcttcc
agcaacaaggttgaaagaccgataaattctgaaacatctacagaaaatagcttaaattta
agagctgtcaagggtccgagtggtgatgatacttcctgttcttttctggtggggaatacc
atgcctccacattcttatgccagagatatcacaatcagtcttctgagaaaagagatagaa
tgtgccttggaaagtttgaaacaagtgcaaaccgagatggcccaactttacaaggagaaa
gaagagagattgttgtctgaggagaggggcagggacagaacaaaatggctcacaaatcaa
ctgctctccctggaaggagttatgaggaactttgaagagcaatcacaacttaagatagaa
gctcttaatcttaagatgcagactgttagccaaactgtgaagagtgcaagcacagattgg
tgcaagacaaaagagttgcttgaatgtgaagttggcgaggctgagatagttgcagcacaa
aagtctgcggaggcttctcttattctagctaaatttgaagaggctcaggataccctgaaa
gaagctgatatcataatcaatgaactagtgatggcaaatgaagtaatgaaactcgatatc
ggtaagctggaaaaaaatgtagggtcattgatgaatgagagggacatgctattgaatgag
gttcaaaacttgcaatccatcagctctcaaaagtgtgagcagattgacagccttgaagag
catattagtttgcacatggcagaaaccagagatatgcttgcaggactgcagggaattgct
ggagagttccagagcacttttgaagaacagttctcatcgctagccaacgacttcaacagc
atgaagtttcaagtctcgaactccacaaagctagtgaagtcatggcttgaagacatctgg
tctgagataattgttagggattgtgctgtgtcaagcttgcacctttgtcacataggaatt
atgttggaaacggtaactggactgaatgctgagaatggtctactccagcatggtctacat
caaaaaaattctctcctcactgatctaagagagcacaatcttaagtcaaaaaaggagctg
gaagtattcagaatcctcaagggaaaattgctagctgacatcaagaacagcttcgatcgc
atctcgaggaaagaagaggaagctggggatatgagaaataaggtaaccggttttgagaaa
aagatattagacctacagtatcaggaggagttaatgttagaaaggtctaatcatatggga
tctcaacttgctattttgatgaaggagttggactggactaactcaaatgccatcaattca
cttctggaacaggagaagctgatgagagcagaagaagaggctttgcattctaagctggag
ctccttaccctagactcgtgctcaaaagacttgatgttgcttatcttgcagaaggagatt
gaagagattgctctccaaaaggctaatctaaacagcaagaatgtcaattcctttgcagct
ttacagaatctgacgagggaaatcattatatccaaagtcgatggagagttaaaagagcag
gtattgttagacaatgagattcagatttctcttctaaagaaagaagttgaggaagcagag
agtaatagactggatttgtctactaagcttggtgaaagcaactcaaggattttacagatg
gatggtgttactagagctctcgaacaagatcttcagctactaaaggaagtcgatcatgca
aacagtttgttaaaagctgaactttcagaaactaaaactactgaatcgaggcttttgaac
cagattgaatcacttgaagctgatcgagagaaaattgcagagaatctaagaacaaaggag
acagcattagactgctcatccaatcagatgtcgtccctggatcagcataatcagaagttg
cagggggacgtttgctcactgaaagcttcattgcaggtgttccaaaatgagttggatcag
aagaatcaggagctgagcagaatggtggggctgagtgaggcatatgagttgcttaacatg
gagatgagtaagttgaaaaacgaaaaaacattagttctccaagatttggcaaagacaaag
tcagaatgcaaatcatcattaagcggcatagacacgttcagtaaggagaacatcaggttg
aatgatcagattattttattggagactaacattgtcagtctaaagactgatttggaggag
aaaaatgctcagctgcatgaaatccagcattctagatcttcgctcttggaggacttgtcg
ctgaaaggggaagaacttcagcgatatacttattctttaagtaatttggagaacgagaat
aagcttttgaggaataagcttcaagttactgaaaaaggcattgagttactcattgcatct
ggcttggaatctgaaatttgtgcggagcttgtcaatacaattgatatctccaatggcaga
ttatatgatgaaatcgcaggcagtgcttttaagagtatgggcaatatgttggagcagaca
catgaagaagcagaacaagtatctaagttcatagaacagatcgagggctttgagcaccat
gttaaagagttgatgtctgaaaactcgactctccggactgagctgctgaggaaggacgac
attctaaagggactgttgtttgatctcagcttgttgcaggagtctgcttctaatacaatc
gatcagaaggatgaaattgaagaaatgacagctgatttggagtctctagagaatgaactt
gctggaaaagtagatgagcttgatgaggccattgctcacagtcaaaagcttgaggctgaa
ttgcaggaaaaagtgcatgccatctctattcttgaattggatatatccaaagaatgtgag
aaggcagattctctttcaaaggaaaatttggatctgaaagcctgtttacaaaaagctttg
gcagaaaaaggttctgctgaggaggacctagttgagagaagcaaagaaattgagagtttg
gagatggagctttcagctatgggcaatgctattgatcaaatgaatgactcgatggagtac
ttgaaaagcaacttagacgaacttaattttgagagggatcagttccaggctgaggtgctt
acactacaagagaaacttgagaaggcctgggccacagctcacaaaaacgaagcagttgct
atagaggcaaaaaggagggctgaagaaagagagacctatgctcttgacaaggaagaggaa
gttaagttgctggagaggtcggtggaagagcttgaacatactataaacgtgctggaaaac
aaagttgacatagttaaaggagaagctgaacgtcaacgtttattgagagaagagttggaa
ttggagcttcattccataaaaagtcagatgcagaatgttcaaaatgctgatgctgacatt
aaaaggcatctagatgagaaaaaagcagacctcgagaaatccctaaaacaagtccagatg
ttggagagggaaattgcagaaaaggatgcagagaatgtacaacttaaagcacatatcact
gagctaaatttgcatgctgaagcacaggcaagtgagtacaagcaaaagttcaaggcactg
gaagcaatggcagaccaagtaaagcctgagggctctttcacccaaaacgcaaatcagttg
tcctacaaatcagagaaaaatacccccaggcctaggggctcaggatcccctttcaaatgc
attggattgggcttggcacagcaggtgaaatctgagaacgttgaggaactaactgctgca
aagctacagattgctgagcttgaatcattagttgtcagcaagcaaaaagagatattctcc
ttgaacgctaaactagctggtgctgagagcatgacacacgatgtaattagagacttgctt
ggagtcaagttggacatgacctcttatgcgtcattgtggcataatcaacaagtggagaag
gtaaacgagaagcctcttttgcaaaaatcagaatctcagtcggaggatcaggaggtaatg
aagctaaagaaagagctcgatgaatttgttgatgaaaggaaaggatggctagaggaaatt
gacagaaggcaggctgaattggtcgctgcccaaattgcattggagaagcatcgccaacaa
gagcagctgctcagtactgaaaaagaagtacttaagactgagaatgtgaagtgcaagaag
aagatcacagagcttcaagatgaaagtctaaagctaagtggccagcagaacctccagcag
cgcattcatcatcatgccaaaatcaaggaagagaataacatgttgaagactcaaaatgaa
gaactggccactaaactacggcgagccgaggttattctttcacgtgtcaaggaagagctc
gcccgccatcgtgcttctgctgggaaggctccgtacataaattttgacgaggaacaaagg
tggaacgacaagtttaaggaagctgaggaggagaagttgcaattagcacagaagctattg
ggcttgtgtaccaggatcttgaaggttgctggatttcgcaaaccacattcagaaatttgc
ccctccgttgctgaagaggctctcgagcaactgaaagacagaatcacttcaatggagagt
gaactgcatgatcttaaaattaagaatagaatcgacaacgaaagagctaggttgtctgag
cttgtgccacaacaagaagagcattcacccagaaaccgacgaccagacgagacctacagg
agttcaaggcgggcatccagaactccatttctttctaccttggatcgatag

DBGET integrated database retrieval system