KEGG   Eucalyptus grandis (rose gum): 104419754Help
Entry
104419754         CDS       T03547                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00020  Citrate cycle (TCA cycle)
egr00190  Oxidative phosphorylation
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104419754
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104419754
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104419754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 DAO GIDA HI0933_like
Motif
Other DBs
NCBI-GeneID: 104419754
NCBI-ProteinID: XP_010029813
LinkDB All DBs
Position
Unknown
AA seq 627 aa AA seqDB search
MWRCIARGLRSPASSGGGGGGSLRSRVSRFFSSESYTIVDHKYDAVVVGAGGAGLRAAIG
LSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGDQDAI
QYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHA
LLHTLYGQAMKHNTQFFVEYFALDLIMNGDGSCQGVIALNMEDGTLHRFQATQTILATGG
YGRAYFSATSAHTCTGDGNAMVARAGIPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGIL
RNNEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVLKE
RLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMA
AGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHRPGEKQKPLEKDAAEKTIAWLD
KIRNSNGSLPTSKIRLNMQRVMQTNAAVFRTQETLEEGCKLIDKAWESFHDVQVKDRSLI
WNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGFWENEK
VRLDYRPVHMNTLDDEIESFPPKARVY
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcattgctcgcggcctccgctctcctgcctcctccggcggcggcggcggc
ggctccctccgatctcgcgtttcccgattcttctcctccgaatcgtacaccatagtcgac
cataagtacgatgccgtcgtcgtaggagctggaggcgcggggttgagagccgccatcgga
ctttctgaacatggtttcaacacggcttgtatcaccaagctctttccaacccggtcacat
actgttgccgctcagggtggtataaatgctgctctgggaaacatgagtgaagatgactgg
aggtggcacatgtatgatactgttaaggggagtgactggttaggtgatcaagacgcaatt
caatacatgtgtagagaggcaccaaaagcagtgattgagcttgagaattatggcctacca
ttttctcgaactgaagatggaaaaatatatcagcgtgcatttggcggccaaagccttgat
tttggaaaaggtggacaggcttatcgttgcgcatgtgcagctgacagaactgggcatgca
ctgttgcacaccctatatggccaagcaatgaaacataacacgcagttcttcgttgaatat
tttgccttggatctaataatgaacggtgatggcagttgtcaaggagtgattgctttgaat
atggaggatgggacactacatcggttccaggccactcaaactattctggccacagggggc
tatggtagagcatacttttctgcaacatcagctcatacatgcacgggagatggcaatgct
atggttgcaagggctggaattccccttgaagatttagagtttgtacaatttcacccaact
ggaatatatggtgccggatgcctcataactgaaggttcacgaggagagggtggtatcctt
cgtaacaatgagggcgaaagatttatggaacggtatgcccctacagccaaggatcttgcg
tcaagagatgttgtctcaagatcaatgaccatggagatacgcgaaggccgtggtgtagga
ccacttaaggaccatatatatcttcatctgaatcatttacctcccgaagtactgaaggag
agacttcctggtatctctgaaactgctgctatctttgctggagtggacgtgacgaaagaa
cccatccctgtcttacccaccgtgcattataacatgggtggtatacccactaactatcac
ggagaggttgttacaatcaaaggcgatgatccagatgcagttgttcctggactcatggct
gctggagaggcagcctgtgcatctgttcatggtgctaatcggcttggtgcaaattctctt
cttgatattgttgtatttgggagagcttgtgctaacagagttgccgaaatacataggcca
ggggagaaacaaaaacctttggaaaaggatgctgctgagaaaactatcgcatggctggac
aagatcagaaattcgaatggctcacttccaacgtctaaaattcggttaaatatgcaacga
gttatgcaaaccaatgctgctgtcttccgtacccaagaaactttggaagaaggttgtaag
ttaatcgacaaggcgtgggaaagcttccatgatgtgcaagtgaaggaccgtagtttgata
tggaactcagacttgattgagactctggagttggaaaaccttctgataaatgcctgtatc
accatgcattctgctgaagccaggaaagagagcagaggagcccatgcccgtgaagacttc
acgaaaagagatgatgaaaaatggatgaagcacactttggggttctgggagaatgagaag
gttcggctagattacagaccagttcatatgaatacgttggacgatgagatcgagtcattc
ccaccaaaggctcgagtgtactaa

DBGET integrated database retrieval system