KEGG   Eucalyptus grandis (rose gum): 104423077Help
Entry
104423077         CDS       T03547                                 

Definition
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00620  Pyruvate metabolism
egr00710  Carbon fixation in photosynthetic organisms
egr01100  Metabolic pathways
egr01200  Carbon metabolism
Module
egr_M00169  CAM (Crassulacean acid metabolism), light
egr_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    104423077
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104423077
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     104423077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 104423077
NCBI-ProteinID: XP_010033838
UniProt: A0A059AI03
LinkDB All DBs
Position
Unknown
AA seq 649 aa AA seqDB search
MISLNRSSFLSNSGVNGSGVNAQRQRRQPPAFVKVIASRSNQDQKGRATSERSGSVLVDS
TLKEMKDHTSSSPIVDPESAVSGGVKDVYGEDSATEDQLVTPWTVSVASGYSLLRDPHHN
KGLAFAEKERDAHYLRGLLPPTVVSQDLQVKKMMHNIRQYQVPLQKYMAMMDLQEMNERL
FYKLLIENVEELLPVVYTPTVGEACQKYGSIFRRPQGLFISLKEKGRILEVLKNWPERSI
QVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACLPVTIDVGTNNEKLLND
DFYIGLRQRRATGQEYAELLHEFMSAVKQIYGEKVLIQFEDFANHNAFDLLEKYGTTHLV
FNDDIQGTASVVLAGLIAAQKLVGGTLADHKFLFLGAGEAGTGIAELIALEMSKQTGAPL
EETRKNIWLVDSKGLIVSSRKESLQHFKKPWAHEHEPIKELVDAVKSIKPTVLIGTSGVG
RTFTKEVVEAMAAINQKPIILSLSNPTSQSECTAEEAYAWSQGRAIFASGSPFPPVEYGG
KVYVPGQANNAYIFPGLGLGLIMSGAIRVHDDMLLAASETLAAEVTQENYDKGLIYPPFA
NIRNISAHIAANVAAKAYELGLATRLPQPEDLVKYAESCMYSPAYRNYR
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatctccttaaaccgctcctctttcctgagcaactcgggcgttaatgggtcgggtgta
aatgcccagaggcagagaaggcaacccccagctttcgtgaaggtcattgcttcgcgctcg
aatcaggatcagaaagggagagcaaccagcgaacgaagcggcagcgttttggtggatagc
actttgaaggaaatgaaggaccatacttcatcttcgcccatcgtggacccagagtccgcc
gtcagtggcggcgtcaaggacgtgtacggtgaagatagcgccacggaggatcagctcgtg
actccctggactgtgtctgtggctagtggatatagtttattgcgagatccacaccataat
aaaggactggcctttgctgagaaagaaagggatgcacactatctgcgtggcctccttccc
ccaacagttgtttctcaggaccttcaggtgaagaaaatgatgcacaacattcgccaatat
caagttcccttgcagaagtacatggccatgatggatcttcaggaaatgaacgaaaggcta
ttttacaagcttctcatagaaaatgttgaggagctactgcctgttgtctacactccaact
gtaggtgaagcttgccaaaaatatgggagcatcttcaggcgtcctcagggcctgtttatt
agcttgaaagaaaaggggaggattcttgaggttttgaagaattggccggagaggagtatt
caggttattgttgtgaccgatggtgagcggatcttgggacttggagatcttggttgccag
ggaatggggataccagtgggaaagctttcattatacactgctcttggaggagtccgtcct
tcagcgtgcttgcctgtgaccattgatgtggggacaaacaatgagaaactgttgaacgac
gacttctacattgggctcaggcagaggagggctactggacaggagtatgctgagcttcta
catgaattcatgtctgcagtcaagcagatctacggggaaaaagtccttatccagttcgaa
gacttcgcaaaccataatgcatttgatctactcgagaagtatggcacaactcatcttgtt
ttcaacgatgatattcagggaacggcatcagttgttcttgctgggcttatcgcagctcaa
aaattagttggcggaacgttagctgatcataagttcttattcctgggagctggagaggct
ggtactggaatagcagaactcatagcccttgagatgtcaaaacagacgggtgctcctttg
gaagagactcgtaagaacatatggcttgttgactcaaagggactgattgttagctcccga
aaggagtctctgcagcacttcaagaagccctgggctcatgagcatgaacccattaaggaa
ctcgtggatgctgtaaaatcaatcaagccaactgtgctgattggaacatctggagtggga
agaacgttcaccaaagaagtggttgaggccatggctgctataaatcagaaaccaataatt
ctttctctttcaaacccgacttcacaatcggaatgtacggcagaagaagcatacgcatgg
agtcagggccgtgccatctttgcaagtggaagcccatttcctcctgttgagtatggaggg
aaggtttatgtccctggccaggcaaataatgcctatatctttcctggacttgggctgggc
ttgataatgtctggcgcaattcgggttcacgatgatatgcttttggctgcatctgagacc
ctggctgcagaggtgactcaggaaaattatgacaagggactcatctacccgcctttcgct
aatatcagaaatatttctgcacatattgcggccaatgtggctgccaaagcttacgaactg
ggtttggcgactcgccttcctcaaccggaagatctggtgaagtatgcggagagctgcatg
tacagccctgcctaccgaaattatcggtga

DBGET integrated database retrieval system