KEGG   Eucalyptus grandis (rose gum): 104424130Help
Entry
104424130         CDS       T03547                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00052  Galactose metabolism
egr00511  Other glycan degradation
egr00531  Glycosaminoglycan degradation
egr00600  Sphingolipid metabolism
egr00604  Glycosphingolipid biosynthesis - ganglio series
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104424130
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104424130
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    104424130
   00604 Glycosphingolipid biosynthesis - ganglio series
    104424130
   00511 Other glycan degradation
    104424130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egr04147]
    104424130
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     104424130
Exosome [BR:egr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104424130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 104424130
NCBI-ProteinID: XP_018719731
UniProt: A0A059AJJ6
LinkDB All DBs
Position
Un
AA seq 713 aa AA seqDB search
MPVRTATSNALPLHRAAPAASRAAAMARKRGLRATTVVFFGLLSLAAFGAFVPALAPLPS
LSSPHPSLPRKSSSRKFEIDSDKFWKDGSPFQIIGGDVHYFRVLPEYWEDRLLRAKALGL
NTIQTYVPWNLHEPKPGETVFEGIADIISFLNLCKKLDLLVMLRVGPYICAEWDFGGFPY
WLLAIKPALTLRSSDPAFVKLVEQWWSILLPKVSSLLYANGGPIIMVQIENEYGSYGDDK
TYLRHLVKLARGYLGNEVILYTTDGGSKETLQKGTVGGEDVFSAVDFDTGAEAWPIFNLQ
KQFNAPGKSPPLAAEFYTGWLTHWGEKLAQTDAEFTAAALEKILSRNGSAVLYMAHGGTN
FGFYNGANTGGSESEYKPDLTSYDYDAPIKESGDVDNPKYKAIRKVVEQYSIVPLPSVPY
NNAKTSYGRIQLQRTSFLFDLLNVLGPHDVVESESPLSMELVGQMFGFLLYATKFASTDD
GSMLTIPKVHDRGQVFVSCASRKDRPLYAGAIERWSNKPLHLPVTKCASRINLYVLVENM
GRVNYGSYMFDMKGILSSVYLNGRVLLGWKMFSIPLHNLNEATTINSVVQVRHSGIMRVL
SNRSINKSDGVTREPAFYAGSFHVNEVAQIKDTFISFQGWGKGVAYVNDFNIGRFWPSFG
PQCNLYVPAPVLRVGVNSLVVLELESPKPDLALHSVDEPDFSCGKSKSSVHHL
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgccagttcgcactgccaccagcaacgctctccctcttcaccgcgcagcgccggccgcc
tccagagccgccgcgatggcgaggaagcgcggcctccgcgccaccaccgtcgtcttcttc
ggcctcctctccctcgccgccttcggggccttcgtcccggccctcgcccctctcccttcc
ctctcctctccccacccttcgctccccaggaagtccagtagtcggaaatttgagatcgac
agtgacaagttctggaaagatggctctccctttcagataattggtggtgatgttcactat
ttccgggtgcttccggagtattgggaagacagattgttgagagcaaaagccctgggtttg
aacactatccagacatatgttccttggaatctgcatgaaccgaaaccaggcgagacagtc
tttgagggaattgcagatataatatcttttctcaacttgtgcaagaagcttgatctcttg
gttatgcttcgagtaggcccttatatatgtgcagagtgggattttgggggcttcccttac
tggctacttgccataaaaccagcgcttacgttaagatcatctgatcctgcatttgtcaag
ttggttgaacagtggtggagcatcctacttccgaaggtttcttctcttctttatgcaaat
ggtggccctataataatggttcagattgaaaatgaatatggctcatatggagacgataaa
acttatcttcgtcaccttgtgaaattggctcggggatacctaggcaatgaagtaatcctg
tacactacggatggaggttctaaggaaactcttcagaaaggaacagttggaggagaagat
gttttctcagctgtggattttgatactggtgctgaggcttggcctatattcaacttgcaa
aagcagttcaatgccccaggaaaatcaccacctcttgcggcggagttttacactggttgg
ctcacacactggggtgagaagcttgctcagacagatgctgaatttactgcggctgcactg
gaaaagattttatcaagaaatgggtctgccgtgctctatatggcacatggtggaacaaat
tttgggttctacaatggagcaaacactggcgggagcgagtccgagtataagcctgacctt
acttcttatgactatgatgcacctattaaagaatctggtgatgtggacaatccaaaatat
aaagctattaggaaggttgtcgagcagtattctatagtgcctcttccttcagtaccttac
aacaatgcaaagacaagctatggaaggattcagctacaaagaacctcttttctttttgat
ttactaaatgttctaggtcctcatgatgttgtcgaatctgaaagccccttgtcgatggag
ttagttggccagatgtttggattcttattatatgcaactaaatttgcttcaacggatgat
gggagtatgcttaccatacccaaggtgcatgatagaggtcaggtgttcgtgtcatgtgct
tcgcgaaaggacagaccattatatgctggtgctattgaaagatggtcaaataaaccactt
catcttccagttaccaaatgtgcatcaagaatcaacttatatgtcttggttgagaacatg
ggtcgagtaaattatggatcctacatgtttgacatgaagggtattctctcttctgtttac
ctaaatggaagagttctgcttgggtggaaaatgttctcaattcctttgcacaacctgaat
gaggcaaccacaatcaattctgttgttcaggtcagacattcaggaatcatgagagttcta
tccaacagaagtatcaataaatctgatggtgtaacaagagaacctgccttttatgctggc
agtttccatgtcaatgaagttgcccagattaaagacacattcatttctttccaaggatgg
ggtaaaggagttgcatatgttaatgacttcaatataggaagattttggccgtcttttggt
ccgcaatgtaacctttatgttcccgcacctgtccttcgagttggggtaaattcactggtt
gttctcgagttagaatccccaaagcctgatcttgccttgcactcggttgatgagccagac
ttctcttgtggtaaatccaaatcgagcgtgcatcatctttaa

DBGET integrated database retrieval system