KEGG   Eucalyptus grandis (rose gum): 104424382Help
Entry
104424382         CDS       T03547                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00040  Pentose and glucuronate interconversions
egr00051  Fructose and mannose metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104424382
   00051 Fructose and mannose metabolism
    104424382
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104424382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C UDPG_MGDP_dh_N NCD3G PALP Sacchrp_dh_NADP Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104424382
NCBI-ProteinID: XP_010035085
UniProt: A0A058ZX44
LinkDB All DBs
Position
Unknown
AA seq 361 aa AA seqDB search
MGKGGMSREGGDEENMAAWLVGLNTLKIQPFTLPPLGPYDVRVSMKAVGICGSDVHYLKT
LRCAHFVVKEPMVIGHECAGIIEEVGSEVKTLVPGDRVALEPGISCWRCDHCKEGRYNLC
PDMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGVHACRRANVGPET
NVLVMGAGPIGLVTMLAARAFGAPRIVIVDVDDHRLSVAKDLGADDIVKVSTDMKDIPEE
VVLIQKAMATEIDVSFDCAGFNKTMSTALNATRSGGKVCLVGMGHNEMTVPLTPAAAREV
DVIGIFRYKNTWPLCLEFLRSGKIDVKPLITHRFGFSQKEVEDAFETSARGGNAIKVMFN
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggtggcatgtctcgcgagggtggcgatgaagagaacatggctgcttggctc
gttggtctcaacaccctcaagattcaacctttcaccctccctccacttggcccctatgat
gtcagagtcagcatgaaggctgttggtatatgtgggagtgacgttcactatctgaagacc
ctaagatgcgcgcatttcgtggtgaaagagcctatggtgattgggcatgagtgtgcaggg
atcatagaagaagtggggagtgaagtcaagacattggttccaggtgatcgagtggcttta
gagccagggatcagctgttggcgttgtgatcattgtaaagaaggccgatacaatctctgt
cctgacatgaagttctttgccactcctcctgttcatggttctctcgccaatcaggtggtg
catccggcagacctttgttttaagcttccagacaatgtgagcttggaggaaggggcaatg
tgcgagcccttgagtgttggagttcatgcttgtcgccgagctaatgtcggtccagagaca
aatgttttggtaatgggtgcagggcctatagggcttgttactatgttagctgcccgtgct
tttggagcacccagaattgtcattgtggatgttgatgaccaccgcttatcagttgcaaag
gatctgggtgcagatgatatcgtgaaagtttctacagatatgaaggacatacctgaagag
gtggtgctgatacaaaaagcgatggcaacagagattgacgtgagctttgactgtgccggt
tttaataaaactatgtcaacggcattgaatgccactcgatctggtggcaaagtttgcctc
gtgggaatgggtcataacgagatgactgtgccgcttactcctgctgctgcaagggaggtt
gatgtgattggcatattccgatacaagaacacatggcctctctgcctcgagtttctaagg
agcggcaagatagatgtgaagcccctcataacccacaggtttgggttctcccagaaggaa
gttgaagatgcctttgagacgagtgcccgtggcggcaatgccatcaaggtcatgttcaat
ctgtga

DBGET integrated database retrieval system