KEGG   Eucalyptus grandis (rose gum): 104424967Help
Entry
104424967         CDS       T03547                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 3, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00071  Fatty acid degradation
egr00410  beta-Alanine metabolism
egr00592  alpha-Linolenic acid metabolism
egr00640  Propanoate metabolism
egr01040  Biosynthesis of unsaturated fatty acids
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
egr01212  Fatty acid metabolism
egr04146  Peroxisome
Module
egr_M00087  beta-Oxidation
egr_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    104424967
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104424967
   00592 alpha-Linolenic acid metabolism
    104424967
   01040 Biosynthesis of unsaturated fatty acids
    104424967
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104424967
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104424967
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     104424967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_ox_N
Motif
Other DBs
NCBI-GeneID: 104424967
NCBI-ProteinID: XP_010035824
UniProt: A0A059A0G8
LinkDB All DBs
Position
Unknown
AA seq 675 aa AA seqDB search
MDRAFWRARVIKNHLTQDPCTQTRSLSGAPCLDYSPPELAEPAAAFDVAAMRALLDGHNV
AERDWLFGLMTQSKLFNPRRVGGRVFVAPDYNQSMEQQREMTMRRIEFLLERGVFEGWLT
AGTAEGELRKLALQEVANIYDHSLAIKFGVHFFLWGGAIQFFGTERHHVKWLRDTENYVV
KGCFAMTELGHGSNVRGIETVTTYDPRAREFIINTPCESAQKYWIGGAANHATHTVAFSQ
LNINGINQGVHAFIVQIRDADGNICPNIRIADCGHKIGLNGVDNGRIWFDNVRIPRENLL
NSVADISPDGEYLSAIKDPDQRFAAFLAPLTAGRVNIAASAIYSAKIGLAIAIRYALSRR
AFSIAPNQPEVLLLDYPSHQQRLLPLLAKTYAMSFSANHLKMIYVKRAPELNKTIHILSS
AFKASFTWHNMRTLQECREACGGQGLKTENRIGHLKGEKDVQSTFEGDNNVLMQQISKTL
FAEYLVARKRNKPFKGLGLEHMNGPCPVLPQQLPSTVLRSDQFQVDAFHVRERDLLNRFA
EEILQRQAQGERKEHALLSSYQLAEDLGRAFSERCVLQNFVEVEENSPAGSLKDMLALLR
SMYALTCMEEDASFLRYGYLSTENAAAVRKEVAKLCSELRPHALALVNSFGIPDAFLSPI
AFNWVEANSWSSVQH
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatcgagccttttggcgcgcccgcgtcatcaagaaccacctgacccaagacccgtgt
acccagacccgttccctttccggcgccccctgcctcgactactccccgcccgagctggcc
gagccggcggccgccttcgacgtcgccgcgatgcgggcgctcctggacggccacaacgtg
gcggagcgggactggctgttcgggctcatgacccagagcaagctcttcaacccccggcgg
gtgggcggccgggtgttcgtcgcgccggactacaaccagtcgatggagcagcagcgggag
atgacgatgaggaggatcgagtttctgctcgagaggggcgtgttcgaggggtggctcacg
gcgggcaccgcggagggggagctgcggaagttggcgctgcaggaggtggccaacatatac
gaccactcgctggcgatcaagttcggggtccacttcttcttgtggggtggcgctatccaa
tttttcggcacagagcggcaccacgtgaagtggttgagagacaccgagaattatgtggtc
aagggttgctttgcgatgactgaattggggcatgggagtaatgttcgaggcattgaaaca
gtaacgacatatgatccaagggccagggagtttattattaacactccatgtgagtcagca
cagaaatattggattggaggagcagcaaatcatgcaacgcacacagtggctttttcccag
ctcaatatcaatgggatcaatcaaggggtccatgcatttatagtacagataagagatgca
gatggcaacatctgtcctaacatacgtatagctgattgtgggcataaaattggtctgaat
ggtgtcgacaatggtcggatatggtttgataacgtgcggattccacgggagaacttgttg
aattcagtggctgacatttcaccagatggggaatatcttagtgctattaaagaccctgat
caaagatttgcagcattcttggccccattaacagctgggcgtgtaaatattgcagccagt
gcaatttactctgccaagattggtttggcgatcgccatacggtatgcattgtcgaggcga
gcattttcaattgcacccaaccagcctgaagtactattgctggactacccaagtcatcaa
cagagactcttacctctccttgcaaagacatatgcaatgagtttctccgctaaccacttg
aagatgatttacgtgaagcgggcacctgaattgaacaaaaccattcacatcctctctagc
gcgtttaaggcttcatttacctggcataacatgcggactcttcaggaatgtcgtgaagct
tgtggaggacaaggcctcaagactgaaaatcgcattggccatttgaaaggtgaaaaagat
gtgcagtccacatttgaaggggacaacaatgttttgatgcaacagataagcaagacactc
tttgctgaatatctagtggctcggaagagaaataagccatttaaagggttgggattggaa
cacatgaatggaccatgccctgtgctaccgcagcagctccccagcactgtgcttagaagt
gaccagttccaggttgatgccttccatgtgagggagagagatttattgaatcgttttgct
gaggagatattgcaacgtcaagcacaaggagaaaggaaagagcatgcattgctttcaagt
taccagcttgcagaagacttgggtcgagctttttcagaacgatgtgtactgcaaaatttt
gtagaagttgaagaaaattcaccagctggttcattgaaggacatgctggctctgctgaga
tccatgtatgccttgacttgcatggaagaggatgcttcattcttgcggtatggctactta
tccaccgagaatgccgctgctgtacggaaggaagtggctaaactctgcagcgagttgaga
ccgcacgcactcgctttggtcaattccttcggcattcctgatgcttttctgagccctata
gcttttaattgggttgaagcaaattcgtggtcttcagttcaacactag

DBGET integrated database retrieval system