KEGG   Eucalyptus grandis (rose gum): 104426018Help
Entry
104426018         CDS       T03547                                 

Definition
(RefSeq) histone deacetylase 5
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:egr01009]
    104426018
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:egr03019]
    104426018
   04131 Membrane trafficking [BR:egr04131]
    104426018
   03036 Chromosome and associated proteins [BR:egr03036]
    104426018
Enzymes [BR:egr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     104426018
Protein phosphatases and associated proteins [BR:egr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104426018
Messenger RNA biogenesis [BR:egr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     104426018
Membrane trafficking [BR:egr04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    104426018
Chromosome and associated proteins [BR:egr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     104426018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 104426018
NCBI-ProteinID: XP_010037238
UniProt: A0A059A473
LinkDB All DBs
Position
Un
AA seq 649 aa AA seqDB search
MEAVASGSDGASRSQQRVGIAYDERMCRHHTPDDEPHPENPNRIRAIWNKLQAAGITQRC
EVLNAKEAEDKYILSVHGKSHVDLIRNISSKQFNSRRNRIASKFNSIYLNEGSSEAAYLA
AGSVIEVAKRVAKGELDSAFAIVRPPGHHAEHDEAMGFCLYNNVAIATNFLLNEKELGIN
KILIVDWDVHHGNGTQKTFWKDPRVLFFSVHRHEFGSFYPASDDGDYTMVGEGPGAGYNI
NVPWENGQCGDADYLAVWDHILIPVAKQFNPDMILISAGFDAAVGDPLGGCRVTPYGYAM
MLKKLMDFARGKIVLALEGGYNVTSISNSALACMEVLLDDKTVAGSTEAYPFESTWRVIQ
AVRQELKAFWSVLADELPTKLTSQKAHIPQILISSSDSEAEDVEELLQDVIRPLSTLRVD
EDHYVLAESASVSWRSVLSKIDIWYATFGSNMWNPRFLCYIEGGQVDGMQKPCSGSMDKS
PPKEILWKTFPHRLFFGMESTRMWGLGGVAFLHPESKNEDIVHMCLYKITLEQFNDVLLQ
ENVSSYDMSSPLFDLTSLDCSKEKGSIDLEAVKNGWYHNVVYLGMEQDIPILTMTCIMSD
IENFKSGKVPLRAPSEDYANTLIRGLVEGGQLSEEEAMSYIKDAATKPL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtggcgtccgggagcgacggcgcgagccggagtcagcaaagggtggggata
gcgtacgacgagaggatgtgcaggcatcacacccctgacgatgagcctcaccctgaaaac
cctaatcgcatcagagccatctggaacaagctccaagctgccggcatcactcaaaggtgt
gaggttttgaatgccaaagaagcagaagataaatatattttgtcagtccacggcaaaagt
catgttgatctgattaggaacataagttccaaacagtttaactctcgcagaaatagaata
gcttcaaagtttaattcaatatacctgaatgaagggtcatcggaagctgcttatcttgct
gctggttctgttatagaggttgctaaaagagttgccaaaggggaattagactctgctttt
gctattgtaaggcctcctggacaccatgctgaacatgatgaagcaatgggattttgtctc
tacaacaatgttgctattgctacaaattttcttttaaacgagaaagaattgggcatcaac
aaaatcttgattgttgactgggatgttcaccacggtaatggtactcagaagacattctgg
aaagatcctcgcgttttgttcttctctgtccataggcatgagtttgggtccttttatcca
gccagtgatgatggtgactatacaatggttggagaaggtcccggggctgggtataatata
aatgtcccatgggagaatggtcagtgtggagatgcggactatctagcagtatgggaccac
atcctgatccctgttgctaagcaattcaatcccgacatgatactaatttctgcgggtttt
gatgcagctgttggtgatcctctgggaggttgtcgtgtcactccatatggatacgcaatg
atgttgaagaagttgatggactttgcacgaggtaagatagtattagcattagaaggagga
tacaatgtcacctcaatttcaaattcagcccttgcatgcatggaagttttgctggatgac
aaaactgtcgctggttccaccgaagcctatccttttgagtccacatggcgagtaatacaa
gcggttcgtcaagaactaaaagctttctggtcagtacttgctgatgaattgccgaccaag
ttaacaagtcaaaaagcacatattccgcaaattctcatttcaagctctgactctgaggcc
gaagatgttgaggaacttctgcaggatgtcattcgacctctttcaactctcagggttgat
gaagatcattatgttcttgcagaatctgcttctgtgtcctggagatcagttctttcgaaa
attgacatctggtatgccacctttggatcaaatatgtggaaccctaggttcctctgctat
attgaaggtggacaggtggatggcatgcaaaagccatgttctggctcaatggacaaaagc
ccgcctaaagagattttgtggaagacctttccgcaccgattattctttggcatggaatcc
acacgcatgtggggtttgggaggagttgctttccttcatcccgaaagcaagaatgaggat
attgtgcacatgtgcctgtataagataacgttagagcagttcaatgatgtcttgcttcag
gaaaatgtttccagctatgacatgagttctcctttgtttgatcttacatctttggactgc
agtaaagaaaaaggatccatcgacttggaagcagtcaagaatggttggtaccataacgtt
gtttacttgggaatggagcaagacatccccatactcacaatgacgtgcatcatgtcggat
attgaaaacttcaagtcagggaaggttcctttgcgtgctccaagtgaagactatgccaac
acgttgataagaggcttggtggaaggagggcagctctcggaagaggaagccatgtcctac
atcaaggacgctgctacaaagcccttatag

DBGET integrated database retrieval system