KEGG   Eucalyptus grandis (rose gum): 104427566Help
Entry
104427566         CDS       T03547                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00052  Galactose metabolism
egr00500  Starch and sucrose metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104427566
   00500 Starch and sucrose metabolism
    104427566
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104427566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104427566
NCBI-ProteinID: XP_018720442
LinkDB All DBs
Position
Un
AA seq 931 aa AA seqDB search
MGGNRDRHGHRRRHRLLSLFPLILCLLSRPSEAGAPGGEGAGTPVVIGYGYTVGSAAVDP
SGTTLTAELRLINRTAVYGPDVEHLRLVPASSFQAGGRLRVQITDADHRRWEVPDDLIPR
RPPTPPRRALPEQTLTPPLPPPPLCRSQCRLSAATSSNLIFDLRNTTPFSFAVSRRSSGH
VLFDTSASDPSAFLVFKDQYLQLSSSLPPGRSSLYGIGEHTKPSLRLLPNQTLTLWNADI
ASANLDVNLYGSHPFYMDVRSSVGGRGHHGGGVGAGTSHGVLLLNSNGMDVVYTSDRITY
KVIGGVLDLYFFPGPSPEAVMEQYTELIGRPTPMPYWSFGFHQCQYGYKNVADLEGVVAG
YAKANIPLEVMWTDIDYMDAYKDFTLDPINFPVEKMKEFVSSLHKDRKKYVLILDPGISV
NETYGTYVRGMQADIFIKREGVPYLGDVWPGPVYFPDFLHPSSESYWGGEIKRFHDVLPF
DGLWLDMNELSNFITSPPLPSILDNPPYKINNLGVHRPINNNTTPATSYHFGNISDYDAH
NLYGLLEARATNKALVNVTGKRPFILSRSTFVSSGKHTAHWTGDNAATWDDLAYSIPAIL
NSGLFGIPMVGADICGFSRDTTEELCNRWIQLGAFYPFARDHSEKNSIRQELFLWKSVAT
SAKKVLGLRYRLLPYLYTLMYEANRKGLPIARPLFFSFPEDTMTYNINSQFLIGKGLMVT
PVLKSGAQTVDAYFPSGNWFDLFNYSNSVSTASGMNVMLNAPPDHPHLHVREGNILAMQG
EAMTTEAARRTPFKLLVVVNGHGNSTGKVFLDDGDDVEMGGEGNKWTLVKFYCEKTWNSV
VVRSEVVNGDFALIEKWVIDKVTILGLRKGTRMTRLRGHELSNDVEATSGQRTVRTMGKL
RDGGEFAIAEVSGLSLPLGKTFKLEVKVRQS
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaaacagagaccgccatggccaccgccgccgccaccgcctcctctccctcttc
ccgttgatcttgtgcctgctgtcgcgtccgtctgaggccggcgcgccgggcggagaaggc
gcggggacgcccgttgtcatcgggtacggatacacggtcgggtccgcggccgttgatccg
tcgggaaccacgttgaccgctgagctccgcctcatcaacaggaccgccgtatatgggccc
gacgtcgagcatctccgccttgtgccagcttccagcttccaagcgggcggtcgtcttcga
gtccaaatcacagacgccgaccaccgccgatgggaagtccccgatgacctcatccctcgc
cgacctccgacccctccccgccgcgctctccctgaacaaaccctaactccgccgctgccg
ccaccgccgctctgccgctcccaatgccgcctctccgccgccacatcctccaacctcatc
ttcgacctccgcaacaccacacccttctccttcgccgtctcccgccgctcctcaggccac
gtcctcttcgacacctccgcctccgacccctcggccttcctcgtcttcaaggaccagtac
ctccagctctcctcctccctccctcccggccgctcctccctctacggtattggagagcac
acgaagccgtcgctccggctcctgcccaaccagacccttactctctggaacgccgacatc
gccagcgcgaacctcgatgtcaacctgtacgggtcgcatccgttttacatggacgtcagg
tcatccgtgggcggccgcggtcaccatggcggaggagttggggcgggcacgagccacggc
gttctgttgctgaacagcaatggcatggacgtggtgtacactagcgataggatcacttac
aaggtgatcggtggggtgttggatttgtatttcttcccggggccgtcgccagaggcagtc
atggagcagtacaccgagctcattggccggccgaccccaatgccatactggtcctttgga
tttcatcaatgccagtatggttacaagaatgtcgcagacttagagggcgtggtagctggt
tatgcaaaagctaatataccattggaagttatgtggaccgacatcgattacatggatgca
tataaagacttcactcttgaccctatcaattttccagtggaaaagatgaaagaatttgtc
agcagccttcacaaggaccgtaaaaaatatgtcctgatacttgatccaggcattagcgtg
aacgagacatatgggacctacgtcagggggatgcaagcagacatcttcattaaacgagag
ggagtcccatacttaggtgatgtttggccagggccggtgtacttccctgacttccttcac
ccatccagtgagagttactggggtggtgagataaagaggtttcatgatgttcttcctttt
gatggcctatggctcgacatgaatgagctgtccaactttataacttctccgcctcttcct
tccattcttgacaatcccccctacaaaatcaacaatttaggagttcatcggccaatcaac
aacaatactactcctgcgacatcatatcattttggcaatatttctgattacgatgctcat
aacctttatggactcctggaagccagagcaacaaacaaggccttagtcaatgttactggt
aaaaggccattcattctctcgagatcaacttttgtgagctctggcaagcacactgcacac
tggactggggacaatgccgcgacgtgggatgacttggcttactcaattcctgcaatttta
aattctgggctttttggaattccaatggtaggagctgatatatgtggtttctctcgagac
acaactgaagagctctgcaaccgatggattcagcttggagccttttatccctttgcaaga
gaccactctgaaaagaactctattcgtcaagagctttttctctggaaatctgtcgccact
tctgccaagaaggtgctcgggcttcgttatcgcttgctcccttacttgtataccttgatg
tatgaggcaaataggaaggggctacccattgcccggcccctatttttctcattccctgag
gatacgatgacttacaatatcaattcccaattcttaattggtaagggtctgatggtgact
cctgtactaaaatcaggtgcccaaaccgtggatgcttattttccaagtggaaattggttt
gatctcttcaattactcaaattcagtgagtacagcttcaggaatgaatgtgatgctcaat
gcgccgcctgatcatcctcatcttcatgtaagggaaggtaatatattggccatgcaagga
gaggccatgactacggaagcagctcggagaacaccattcaagctattagttgtggtcaat
ggccatgggaatagcacaggaaaagtgttcttggacgatggagatgatgtcgaaatggga
ggggaaggaaataagtggactctggtgaagttttattgtgagaaaacatggaatagtgtt
gttgtcagatcagaagttgttaatggggattttgctctaattgagaagtgggtaattgat
aaggtgacaattctaggattgagaaaaggaactagaatgacgagactgagagggcatgaa
ttatccaatgatgtagaagcaacatccggacagagaacggtgagaacaatgggaaaattg
agggatggtggagagtttgcgattgctgaagtctcaggattgtcacttccactggggaag
acattcaagttggaagtgaaagtgcgccaatcctaa

DBGET integrated database retrieval system