KEGG   Eucalyptus grandis (rose gum): 104428963Help
Entry
104428963         CDS       T03547                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00052  Galactose metabolism
egr00500  Starch and sucrose metabolism
egr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104428963
   00500 Starch and sucrose metabolism
    104428963
Enzymes [BR:egr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104428963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 104428963
NCBI-ProteinID: XP_018721993
LinkDB All DBs
Position
Un
AA seq 880 aa AA seqDB search
MRSSRDHHRCLPPLFALLVFLYLLSSPSLYLLSSPSDVRASVGEGERMPDVVGYGYTVGS
MAADTSGTALTAELSLINVTTIYEPDAESLRLVASFEASGRLRVRITDADRRQWEVPDDL
IPRRPPSHPYQTPTPPPSPSGSHRCFSGASSDLVFDLRNTTPFSFPVSRCSSGDVLFDTS
TSDPSAFLVFKDQYLQLSSSLPPGCSSLMDIKSSVGDGSRGVGAGMSHGVLLLNSNGMDV
VYTGDRITYKVIGGVLDLYFFPGPSPEAIMEQYTKLIGRPTPMPYWSFGFHQCRWGYMNV
SNLEGVVVGYEKANIPLEVMWTDIDYMDANKDFTLDPINFPMEKMKEFVSSLHKNHQKYV
PILDPGISVNETYGTYIRGMQANIFIKREGVPYLGVVWPGPVYFPDFLHPSSESYWGGEI
KRFHDVLPFDGLWIDMNELSNFNDSPPVPSTLDNPPYKMNNAGVHRPINNKTIPAMSLHF
GNISYYNAHNLYGLLEARATNKALVNVTGKRPFILSRSTFLSSGKHTAHWTGDNAATWDD
LAYSVPAILNFGLFGIPMVGADICSFFGDTTEELCNRWIQLGAFYPFARDHSDKGTIRQE
LYLWESVAASARMVLRLRYRLLPYLYTLMYEANRRGIPIARPLFFSFPEDTMTYNINSQF
LIGKGLMVTPVLKSGAQTVDAYFPSGNWFDLFNYSNSVSTASGMNVMLNAPRDHPHLHVR
EGNILAMQGEAMTTEAARRTPFKLLVVVDGHGNSTGQVFLDDGDDVEMGGEGNKWTLVKF
YCEKTENGVVVRSEVVNREFALIEKWVIDKVTILGLRKGTRMTRLRGHELSNDVEAMSGQ
RTMKTMGKSSDGGEFAIAEVSELSLPLGKTFKLEVKVRQS
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtagcagagaccatcatcgctgtcttccgcctctctttgcgttgttggtcttc
ttgtacttgctgtcgtctccgtccttgtacttgctgtcgtctccgtcagacgtccgcgcg
tcggtcggagaaggtgagaggatgcccgacgtcgtcgggtacggatacacagtcgggtcc
atggccgccgacacgtcgggaacagcgttgaccgccgagctcagcctcatcaacgtgacc
accatctacgagcctgacgccgagagcctccgccttgttgccagcttcgaagcgagcggt
cgtcttcgagtccggatcacagacgctgaccgccgacaatgggaagtccccgacgacctc
atccctcgccgacctccctcccatccataccaaaccccgactccgccgccatccccctcc
ggctctcaccgctgcttctccggcgcctcctccgacctagtcttcgacctccgcaacacc
acccccttctccttccccgtctcccgctgctcctccggcgacgtcctcttcgacacctcc
acctccgacccctccgccttcctcgtcttcaaggaccagtacctccagctctcctcctcc
ctccctcccggctgctcctcccttatggacatcaagtcgtccgttggcgatggcagcaga
ggagttggggcgggcatgagccatggcgttctgttgctgaacagcaatggcatggacgtg
gtgtacactggcgataggatcacttacaaggtgatcggtggtgtgttggatttgtatttc
ttccccgggccatcaccggaggcgatcatggagcagtacaccaagctcattggccggccg
accccgatgccatactggtccttcggatttcatcaatgccggtggggttacatgaatgtc
tcaaacttagagggcgtggtagttggttatgaaaaagctaatattccactggaagtcatg
tggaccgacattgattatatggatgcaaacaaggacttcactcttgaccctatcaatttt
ccgatggaaaagatgaaagaatttgtcagcagccttcacaagaaccatcaaaagtatgtc
ccaatacttgatccaggcattagtgtgaacgagacatatgggacctacatcagggggatg
caagccaacatcttcatcaagcgtgagggagtgccatatttaggtgttgtttggccaggg
ccagtgtacttccctgacttccttcacccatctagtgagagttattggggtggggagata
aagaggtttcacgatgttcttccatttgatggcctatggatcgacatgaacgagttgtcc
aacttcaatgattctccgcctgttccttccactcttgacaatcctccctacaaaatgaac
aatgcaggagttcatcgccctatcaacaacaaaactattccagcaatgtcacttcatttt
ggcaatatttcatattacaatgctcataacctctatggacttttggaagccagagcaaca
aacaaggccttagtcaatgttactggtaaaaggccattcattctctcaagatcgactttt
ctaagctctggcaagcacactgcacactggactggagacaatgccgccacatgggatgac
ttggcttactcagttcctgcaattttaaattttgggctctttggaattccaatggtagga
gctgatatatgcagtttctttggtgacacaaccgaagagctctgcaaccgatggattcag
cttggagctttttatccctttgcaagagaccactctgataagggtactattcgtcaagag
ctctatctctgggaatcggtcgctgcatccgccagaatggtgctcaggcttcgttatcgc
ttgctcccatacttgtataccttgatgtatgaggcaaatagaaggggaatacccattgcc
cggcccctatttttctcattccccgaggatacaatgacttacaatatcaattcccaattc
ttaattggtaagggtctgatggtgactcctgtactaaaatcaggtgcccaaactgtggat
gcttattttccgagtggaaattggtttgatctcttcaattactcaaattcagtaagtaca
gcttcaggaatgaatgtgatgctcaatgcgccgcgtgatcatcctcatcttcatgtaagg
gaaggtaatatattggccatgcaaggagaggccatgactacggaagcagctcgaagaaca
ccattcaagctgttagttgtggttgatggccatgggaatagcacaggacaagtgttcttg
gatgatggagatgatgtcgaaatgggaggggaaggaaataagtggactctggtgaagttt
tattgtgagaaaacagagaatggtgttgttgtcagatcagaagttgttaatagggaattt
gctctgattgagaagtgggtaattgataaggtgacaattctaggattgagaaaaggaact
agaatgacgagattgagagggcatgaattatccaatgatgtagaagcaatgtccggacag
agaacaatgaaaacaatgggaaaatcgagcgatggtggagagtttgcgattgctgaagtc
tcagaattgtcacttccactggggaagacattcaagctggaagtgaaagtgcgccaatcc
taa

DBGET integrated database retrieval system