KEGG   Eucalyptus grandis (rose gum): 104432993Help
Entry
104432993         CDS       T03547                                 

Definition
(RefSeq) glutamate decarboxylase 4
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00250  Alanine, aspartate and glutamate metabolism
egr00410  beta-Alanine metabolism
egr00430  Taurine and hypotaurine metabolism
egr00650  Butanoate metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104432993
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104432993
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104432993
   00430 Taurine and hypotaurine metabolism
    104432993
Enzymes [BR:egr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104432993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 104432993
NCBI-ProteinID: XP_010043901
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSEAAVG
VGTVGSSEAIMLAGLAFKRKWQNMRRAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPVKAVELVDENTICVAAILGSTLNGEFEDVKLLNDLLLEKNKQTGWNTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGEEGYRNVMENCHENAMVLKEGLEK
TGYFNIVSKDEGVPLVAFSLNDNSRHDEFEVSEMLRRFGWIVPAYTMPADAQHVTVLRVV
IREDFSRTLAERLVQDIKKVIHDLDALPAKIKAKMSADCTAQENGRVNGVKKTAMETQRE
ITDAWKKFVLESKTNKNKIC
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaaaaccgcctctgagtccgacgtctcgatccactccacctttgcgtct
cgctatgtccggacctcgctccccaggttcaagatgccggagaactccataccgaaggag
gcggcgtaccagataataaacgacgagctgatgctggacgggaacccgaggctgaacctg
gcctcgttcgtgacgacatggatggagccggagtgcgacaagctcatcatggactccatc
aacaagaactacgtcgacatggacgagtaccccgtcaccaccgagttgcagaaccgatgt
gtgaacatgatagctcatcttttcaatgcaccgctgggagactcggaggcagctgtggga
gtggggacggttgggtcgtcggaggccatcatgctcgccgggctcgctttcaagcggaag
tggcagaacatgcgcagggcccagggcaagccctgtgacaagcccaacatcgtcaccggc
gccaacgtccaggtgtgctgggagaaatttgctaggtacttcgaggtggagctcaaggag
gtgaagctgagggaaggctactatgtgatggacccggtgaaggcagtggagctggtggat
gagaacaccatctgcgttgccgccatccttggctccaccctcaacggcgagttcgaggac
gtcaagcttttgaacgacctgttgctcgaaaagaacaagcaaaccggatggaataccccg
atccacgttgacgcggccagtggcgggttcattgcgccgttcctgtacccagagctcgag
tgggacttccggcttccgctggtcaagagcatcaatgtcagcgggcacaagtacgggctg
gtctatgctgggatcgggtgggtcatctggaggagcaaagaggacttgcctgaagagctc
atctttcacataaactatcttggtgctgatcagcccaccttcaccctcaacttctccaaa
ggctcaagtcaagtgattgctcaatattaccaacttatcaggttgggcgaagagggatac
cgaaacgtgatggagaactgccacgagaacgcgatggtgctgaaggaggggctcgagaag
acaggctacttcaacatcgtctcgaaggacgaaggggtcccccttgtggccttctcgctc
aacgacaacagccgccatgacgagttcgaggtgtccgagatgctgcgccggttcgggtgg
attgtccctgcctacaccatgcccgcggacgcccagcacgtcactgtgctccgtgtggtg
ataagagaggacttctcgcgcacgctggccgagcgcctcgtgcaggacatcaagaaggtg
atccacgacctcgacgcgctccctgcgaagatcaaggccaagatgagcgccgactgcact
gcccaggagaacgggagggtcaacggcgtgaagaagacggcgatggagacacagagggaa
atcacggatgcctggaagaagtttgtcttggaaagtaagactaacaagaacaagatatgc
tga

DBGET integrated database retrieval system