KEGG   Eucalyptus grandis (rose gum): 104433278Help
Entry
104433278         CDS       T03547                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 3B, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00630  Glyoxylate and dicarboxylate metabolism
egr00710  Carbon fixation in photosynthetic organisms
egr01100  Metabolic pathways
egr01200  Carbon metabolism
Module
egr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
egr_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
egr_M00532  Photorespiration
egr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    104433278
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104433278
Enzymes [BR:egr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     104433278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 104433278
NCBI-ProteinID: XP_010044264
UniProt: A0A059D765
LinkDB All DBs
Position
Un
AA seq 179 aa AA seqDB search
MASASMLSSPAVRATPAQATMVAPFTGLKSASAFPVTRKSSEDITSLSSNGGRVQCMQVW
PPIGKKKFETLSYLPPLSPESLAKEVDYLLRSGWVPCLEFELEHGFVYREHHSSPGYYDG
RYWTMWKLPMFGCTDSAQVLKELEEAKKAYPTAFIRIIGFDNKRQVQCISFIAYKPPGF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagcctcaatgctctcgtctccagccgtccgggctaccccggctcaggccacc
atggtcgccccattcaccggcctcaagtccgcctcggctttcccggtcacccgcaagtcg
agcgaggacatcacctctctttccagcaatggcggaagagtccaatgcatgcaggtgtgg
cctccgattggcaagaagaagttcgagacgctgtcctacctccctcccctctctcccgag
tccttggccaaggaagtcgactaccttcttcgcagcggatgggttccctgcctcgaattc
gagctcgagcacgggttcgtgtaccgcgagcaccacagctcccccgggtactacgacggg
cgctactggacaatgtggaagctccccatgttcgggtgcaccgactcggcccaggtgttg
aaagagctggaggaggccaagaaggcttatcccacggcgttcatccggatcatcgggttc
gacaacaagcgccaagtgcagtgcatcagcttcatcgcctacaagccccccggcttctaa

DBGET integrated database retrieval system