KEGG   Eucalyptus grandis (rose gum): 104433414Help
Entry
104433414         CDS       T03547                                 

Definition
(RefSeq) EGF domain-specific O-linked N-acetylglucosamine transferase
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    104433414
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:egr01003]
    104433414
Enzymes [BR:egr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     104433414
Glycosyltransferases [BR:egr01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   104433414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-GeneID: 104433414
NCBI-ProteinID: XP_010044456
LinkDB All DBs
Position
Unknown
AA seq 472 aa AA seqDB search
MRKRSQGARVVLVGLVFLVALLVLRINVSTLSRLSVTSPPRSLNKNGQGTKWLLQREITR
VPLNSRSQSPPESREVSAAAAITCDRSHHAYDTCAVNRPTLLHPRTATFFLLRPTAGRLS
PEKIRPHPRKWENSTMSKIKEFTLASAGPPEGLRCDVEHDAPALAISVGGYAGNFFHQFG
DGLVPLYVTANTVFPGRDFVLVIDGASDQWMHKYEDLLRALSDRPVVYVDRANASHCFPS
ASVGLISHGFMTINPKLTPNSRSFLHFRRFLDEAYRRNRPGAAPRPPARRPRLVITARTG
GVGRVILNQKEVEDLARAIGFEVAVFEPNRSTPLRKAYELINSSHALVGVHGAALTHALF
LRPGAVLGQVVPIGGDWVARACFEEPARAMGLSYVEYGIAPEESSLVEKYGRDNVLLRDP
AAAKGGGGWSAKVMNVYLKEQNVRLDLVRFRGFLEKVYGKARKFMEDEEGKG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagaggagccaaggggctcgggtggtgctggtaggccttgttttcctcgtagcg
ctcctggtgcttcgcatcaatgtctcgaccttatccaggctgagcgttacttctcctcca
cgatccctcaacaagaacggtcaaggtacgaaatggctgttgcagcgagagattacgcgg
gtcccactcaacagccgatcgcaatcccctcctgaatctagagaagtatcagcagcggca
gcaatcacctgcgaccggtctcaccacgcgtacgacacctgcgccgtcaaccgccccacc
ctcctccacccgcgcaccgccacgttcttcctcctccgccccaccgccggccgcctctcg
ccggagaagatccgcccccacccgcgcaaatgggagaactccaccatgtccaagatcaaa
gagttcaccctcgcctccgccgggcccccggagggcctccggtgcgacgtcgagcacgac
gcccctgccctcgcgatcagcgtcggcggctacgccggcaacttcttccaccagttcggc
gacggcctcgtccccctctacgtcaccgccaacaccgtcttccccggccgagatttcgtc
ctcgtgatcgacggggccagcgatcagtggatgcacaagtatgaggacttgctccgagct
ctcagcgatcgtcccgtcgtatacgtcgaccgcgccaacgcctcgcattgcttcccttcc
gcttcggtcgggttgatctctcacggattcatgacgataaaccctaaattgactcctaat
tccagaagcttcttgcatttccgccgattcctggatgaggcgtaccggcgcaaccgcccc
ggggccgctcctcggcctccggcgcggaggccgcggctcgtgatcaccgccaggaccgga
ggcgtcgggcgagtgatcctgaaccagaaggaagtcgaggacctggcgagggcgatcggc
ttcgaggtggccgtcttcgagccgaaccggagcacgccgctgcggaaggcgtacgagctg
atcaactccagccacgcgctggtcggcgtgcacggggcggcgctcacgcacgcgctgttc
ctccggccgggagcggtgctggggcaggtggtgccgatcggaggggactgggtggcgcgc
gcgtgcttcgaggagccggcgcgggccatggggctgagctacgtggagtacgggatcgcg
ccggaggagagcagcctggtggagaagtacgggagggacaacgtgctgctgagggacccg
gcggcggccaagggcggcgggggttggtcggcgaaggtgatgaacgtgtacttgaaggag
cagaatgtgaggttggatttggtgaggtttagggggtttctggagaaggtgtacggaaag
gccaggaaattcatggaggacgaggaaggaaagggttaa

DBGET integrated database retrieval system