KEGG   Eucalyptus grandis (rose gum): 104438216Help
Entry
104438216         CDS       T03547                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00010  Glycolysis / Gluconeogenesis
egr00051  Fructose and mannose metabolism
egr00052  Galactose metabolism
egr00500  Starch and sucrose metabolism
egr00520  Amino sugar and nucleotide sugar metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Module
egr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
egr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104438216
   00051 Fructose and mannose metabolism
    104438216
   00052 Galactose metabolism
    104438216
   00500 Starch and sucrose metabolism
    104438216
   00520 Amino sugar and nucleotide sugar metabolism
    104438216
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104438216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egr04131]
    104438216
Enzymes [BR:egr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104438216
Membrane trafficking [BR:egr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104438216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 104438216
NCBI-ProteinID: XP_010049611
UniProt: A0A059CWK1
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MGKKVAVVLCVAAAAVVAAGAAVVVRRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVA
DAMTVEMHAGLASEGGSKLKMLISYVDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEK
GVVSQEFEEVSIPPYLMIGSSEALFNYIAEALAKFVATESEGSHPYPGRQRELGFTFSFP
VRQVSISSGTLIKWTKGFSIEDAVGEDVVGELTKAMEKIGLHMRVTALVNDTIGTLAGGR
FYNSDVIAAVILGTGTNAAYVERAQAIPKWHGPLPKSGEMVINMEWGNFRSSHLPLTEYD
QALDSESLNPGEQIFEKTISGMYLGEVVRRVLLKMAEEASFFGDNVPPKLRISFILRTPD
MSAMHHDTSSDLKVVGNKLRDILEISNTTLKMRKVVVELCDIVATRGARLSAAGIVGILK
KLGRDSAKEGAEQQKSVIALDGGLFEHYKKFSACMESTLKELIGEEVAQNIVIEHSNDGS
GIGAALLAASHSEYLMAEEP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaggtggcggtggtgctgtgcgtggcggcggcggcggtggtggcggcgggg
gcggcggtcgtcgtgaggaggcagatgaagagatccgggaaatgggccagggccatggcc
atactgaaggagtttgaggacaagtgtgggaccccaatcgggaagctccgccaggtggcg
gacgccatgaccgtcgagatgcacgccgggctcgcatccgagggcgggagtaagctcaag
atgctcatcagctacgtggacaatctccccactgggaatgagcaaggattgttttatgca
ttggacctgggtggtacaaatttccgggtccttcgtgttcagttgggaggaaaggaaaag
ggtgttgtttcccaagaatttgaggaagtttcaatacctccttacttaatgattggatct
tcagaagctttgtttaattacattgctgaggcacttgcgaagtttgttgccacagaaagt
gaaggttctcatccttaccctggtaggcaaagggagctaggctttaccttctccttcccc
gttaggcaagtatctatatcgtcagggacattaatcaaatggacaaagggcttttccata
gaagatgcggttggggaggacgttgtgggtgaactgaccaaagcaatggaaaaaattggc
ctccacatgcgtgtaacagctttggttaatgacacaatcggaacattagctgggggcaga
ttctacaattccgatgtaattgctgctgtcattttgggtaccggaacaaatgcagcttat
gttgaaagggctcaggcaattcctaagtggcatggtcctctgcctaaatcaggagaaatg
gtcattaacatggaatggggcaacttcaggtcgtcacaccttcccctgacagagtatgat
caggcactggatagtgaaagtcttaacccaggagagcagatttttgagaagacaatatca
ggcatgtacttgggagaagttgtgcgtagagttttactgaaaatggctgaagaagcttca
tttttcggtgacaatgttcctcctaaattaagaatctctttcatattaaggacaccggac
atgtctgctatgcatcatgacacgtcttccgatcttaaagttgttgggaacaaactgagg
gatatcttagagatatccaatactaccttgaagatgagaaaagtggttgttgagctctgt
gacattgtcgccactcgtggagctcgcctatctgctgctgggatagttgggatcctgaaa
aaactgggaagagacagcgcaaaagagggagcagaacagcagaagtcagtaattgcactt
gacggtggtttgttcgagcactacaaaaaattcagtgcctgcatggagagcactctaaaa
gagttgattggagaggaagtcgcgcagaacattgttattgagcactcaaatgacgggtct
ggcataggagctgcccttttagcagcttcgcactccgaatatctcatggctgaggagcct
tga

DBGET integrated database retrieval system