KEGG   Eucalyptus grandis (rose gum): 104442252Help
Entry
104442252         CDS       T03547                                 

Definition
(RefSeq) transketolase, chloroplastic
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00030  Pentose phosphate pathway
egr00710  Carbon fixation in photosynthetic organisms
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
egr01230  Biosynthesis of amino acids
Module
egr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
egr_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
egr_M00165  Reductive pentose phosphate cycle (Calvin cycle)
egr_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
egr_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    104442252
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    104442252
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    104442252
Enzymes [BR:egr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     104442252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh XFP_C KfrA_N
Motif
Other DBs
NCBI-GeneID: 104442252
NCBI-ProteinID: XP_010053907
UniProt: A0A059CK22
LinkDB All DBs
Position
Unknown
AA seq 748 aa AA seqDB search
MASTSSPTLSQAILARPISGSASNSSSSDRVSLSLSALKFSPLSSSRRASGSSCRRRRSS
VQGPSSAVRPIRAAAVETLDTATEASLVEKSVNTIRFLAIDAVEKANSGHPGLPMGCAPM
GHILYDEVMRYNPKSPYWFNRDRFVLSAGHGCMLQYALMHLAGYDSVQEEDLKGFRQWGS
KTPGHPENFETTGIEVTTGPLGQGIANAVGLALVEKHLAARFNKPDSEIVDHYTYVILGD
GCQMEGISNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTESVDTRFEGLGWHVIWV
KNGNTGYDEIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANSYSVHGSALGAKEVDATR
KNLGWPYEPFHVPEDVKAHWSRHVPAGAAIEAEWNAKFAEYEKKYKEEAAELKSIFKGEL
PAGWEKALPTYTPESPADATRNLSQQCLNALAKVLPGLLGGSADLASSNMTLLKMFGDFQ
KGTPEERNVRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRAAMRISALCEAGV
IYVMTHDSIGLGEDGPTHQPIEHLASFRAMPNILMLRPADGNETAGAYKVAVLNRKRPSV
LALSRQKLPQLSGTSIEGVEKGGYIISDNSSGNKPDVILIGTGSELEIAVKAADELRKEG
KAVRVVSFVSWELFDDQSAEYKESVLPAAVSARVSIEAGSTFGWSKIVGSGGKAIGIDRF
GASAPAGIIYKEFGITAEAVVAAAKELC
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggcttccacctcgtccccgacgctgtcccaggccatcttggcccgacccatctccggc
agcgcctccaattcctcctcctccgaccgcgtctccctctccctctccgccctcaagttc
tctcccctctcctcctccaggcgcgcctccggctcctcctgccgccgccgccgcagcagc
gtccagggtccctcctcggccgtccgacccatcagggccgccgccgtcgagaccctcgac
accgccaccgaggcctccctggtcgagaagtcggtcaacaccatccggttcctggccatc
gacgccgtcgagaaggcgaactccggacacccgggactgcccatggggtgcgccccgatg
ggtcacatcctgtacgacgaggtcatgaggtacaaccccaagagcccctactggttcaac
cgcgaccggttcgtgctgtcggccgggcacggttgcatgctgcagtacgcccttatgcat
ctcgctgggtatgacagcgtccaggaggaagacttgaaaggcttccggcagtggggaagc
aagacccctggccatccggagaactttgagacaaccggtatcgaagttacaacaggtcca
ctcgggcaaggaattgccaatgctgttggtttggcactcgtagagaagcatttggctgct
cgcttcaataaaccagacagtgaaatagttgaccactacacatatgtcatccttggagat
ggttgccagatggagggtatttccaatgaagcttgttcacttgctggtcactggggactt
ggaaagttgattgctttctatgacgacaaccacatctctatcgatggcgatacggaaatt
gcattcaccgagagtgttgacacccgtttcgagggtcttggttggcatgtcatatgggtg
aaaaacggaaacactggctatgatgagatacgtgctgctattaaggaagcgaaggctgtc
aaggataagcctacattaattaaggtgactaccaccattggctacggttcacctaacaag
gccaactcatatagtgtgcatgggagcgcactgggtgccaaggaagtcgatgcaacaagg
aagaaccttggttggccatatgaacctttccatgtgcctgaggatgtcaaagcgcactgg
agtcgccatgtccctgctggcgctgctattgaagctgaatggaatgccaagtttgccgag
tatgagaagaagtacaaggaagaagctgcagaactgaagtccattttcaagggtgaactg
cctgctggttgggaaaaagcacttccgacgtatactcctgagagtcctgctgatgccacc
aggaatctctctcagcaatgcctgaatgccctcgctaaagtgctgcctggtcttcttggt
ggcagtgctgatcttgcttcttccaacatgacactgcttaagatgttcggtgatttccaa
aagggcaccccggaggaacgcaatgtcaggttcggtgttagagagcatggaatgggagct
atttgcaacgggattgccctgcacagccctggtctcattccatactgcgccacgttcttt
gtcttcactgactacatgagggctgcgatgaggatctctgccctttgtgaagctggagtt
atctacgtgatgacccatgattcaattggtcttggagaggacgggccgacccatcaacct
attgagcacttggccagcttccgtgctatgcccaatattttgatgcttcgaccagctgat
gggaatgaaaccgcaggtgcgtacaaggttgctgtcctcaacaggaagagaccttctgtc
cttgctctctccaggcagaagctgccccagctttccggaacttccattgaaggagtcgaa
aaaggtggttacatcatttcggacaactcttcaggcaataagcccgatgtcatcttgatt
ggaactggttctgagttggaaattgctgtgaaagcagcagatgaactgagaaaggaaggg
aaggctgtgagagttgtatcatttgtttcatgggagctctttgacgatcaatctgctgag
tataaagaaagcgttttgccagctgccgtatccgctagggtcagcattgaagctgggtca
acctttggatggtcgaaaatcgtcggaagcggagggaaggctattggaatcgaccgcttc
ggggccagtgctccggcaggtataatttacaaggagttcggcatcactgccgaggccgtc
gttgcggcagctaaagagctttgctag

DBGET integrated database retrieval system