KEGG   Eucalyptus grandis (rose gum): 104443734Help
Entry
104443734         CDS       T03547                                 

Definition
(RefSeq) protein cornichon homolog 4
  KO
K20368  protein cornichon
Organism
egr  Eucalyptus grandis (rose gum)
Brite
KEGG Orthology (KO) [BR:egr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egr04131]
    104443734
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egr02000]
    104443734
Membrane trafficking [BR:egr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    104443734
Transporters [BR:egr02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   104443734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon CobS
Motif
Other DBs
NCBI-GeneID: 104443734
NCBI-ProteinID: XP_010055548
LinkDB All DBs
Position
Unknown
AA seq 137 aa AA seqDB search
MEDLFGWLVSFFAVVALIVVVIYQLMCLADLEFDYINPYDSASRINAVILPEFIGQGVLL
LFYVLTRHWVMALLCVPYLYYNVTLYNQKKHLVDVTEIYNMLKWEKKKRLFKLGYLVLLL
FLSLFWLIYSALDDHEE
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctgttcgggtggctggtctccttcttcgccgtcgtcgccctcatcgtcgtc
gtcatctaccagctcatgtgcttggccgatctggagttcgattacataaacccttatgat
tctgcatcacggattaatgcagtgatcttaccggagtttatcggacagggagtcttgttg
ctgttttatgtcttgacaagacattgggttatggccctcttgtgtgtgccatacctctat
tacaatgtgacactgtacaatcagaaaaagcacttggtagatgttactgagatatacaac
atgctcaagtgggaaaagaagaaaaggctctttaagctgggctatctagtattgttgctc
ttcctctccttattttggttgatctatagcgcactggacgatcacgaagaatga

DBGET integrated database retrieval system