KEGG   Eucalyptus grandis (rose gum): 104449680Help
Entry
104449680         CDS       T03547                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr03030  DNA replication
egr03410  Base excision repair
egr03420  Nucleotide excision repair
egr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:egr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104449680
   03410 Base excision repair
    104449680
   03420 Nucleotide excision repair
    104449680
   03430 Mismatch repair
    104449680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egr03032]
    104449680
   03400 DNA repair and recombination proteins [BR:egr03400]
    104449680
Enzymes [BR:egr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104449680
    6.5.1.6  DNA ligase (ATP or NAD+)
     104449680
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104449680
DNA replication proteins [BR:egr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104449680
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104449680
DNA repair and recombination proteins [BR:egr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104449680
   NER (nucleotide excision repair)
    Other NER factors
     104449680
   MMR (mismatch excision repair)
    Other MMR factors
     104449680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 104449680
NCBI-ProteinID: XP_010062219
LinkDB All DBs
Position
Unknown
AA seq 1395 aa AA seqDB search
MASSETATPSSSFDSARLFLAATGTPSLPLPPPSPPPSDLPASKLIPGTCFLVDAFRFAG
DHSVSYFLSHFHSDHYTGLSPAWSRGVVFCSPTTSRLLIDVLGVPARLVVSLPVGEALSI
DGCEVRLVDANHCPGAVMFLFKVPGGGGGEFRRYVHTGDFRFRDSMRSEPGLGEFVACDA
IFLDTTYCNPKFVFPSQEESIDYVASVIERVGVENRDSAKNILFLVATYVIGKERILLEV
ARRCGCKVYVDGRKMAVLRALGYSESGAFTEDESETAVHVVGWNVLGETWPYFRPNFVQM
KELIVEKGYNKVVGFVPTGWTYEVKRDKFAIRKKDSFEIHLVPYSEHSNYNELREFVKFL
KPKRVIPTVGSDIEKLDGKHFHRVQKLFAGLLDETANKKEFLMNFLPWSSEKENIVAGVV
ATASNDALMQEKEKLSKEDHSETLDPKFFLGETTDLKKGGFEELDLVSEEREKEILQALQ
DCLPAWVTRDQMTGLINSSGRNLVDAVSNFYEKETEFYQQVSASASASSSSLQASFMSSS
DVHSSPSAPDSVKGSASGTRSMFSKDYKLPTVQLTMTSKSPGKKKRNVSNSPKKKQKSAP
KKLESSGSGQSRITRFFTKSVANSAQDGGLEANFQPCFKDDKFSSPYNDKIDQFVQIVNG
DDSLRSYAASILEKTKGDIDKALDVYYSDTESRPVDNNDISFVSLASGQSVTASDGKFTA
GHITLSEKSGSVAAISLERPLAEICTDFVSVPLEKYNPVEHASWRLGDPAPYIHLARTFD
LVEREKGKIKVTSMLCNMFRSLLALSPEDVLPATYLCTNKIAPDHENMELNIGGSLVAAA
IEDVCGVKRSKIRDMYNRLGDLGDVAQECRQTQTFLAPPPVLLIKDVFSVLKKISFQTGS
GSNARKKSLIVSLMRSCREMEMKFIVRTLVRNLRIGAMMRTVLPAFAQAVVMNSSLEDTS
QKSEKIKSLSASILEAYNVLPSLDLIIPSLMKEGIEFSSSHLSMIPGLPIKPMLAKITDG
CPSVLKLFESRAFTCEYKYDGQRAQIHKLADGSIRIFSRNGDETTSRFPDLIAIVNESCK
PSAVTFILDAEVVAVDRKRGSKLMSFQELSSRERGGRDSLVSLDSIKVDICIFVFDVMFA
NGEQVLGFPLRERRKVLRELFNDEKKGFFEYVKEMTVDAEDSHLDREDTLTRMNLFLEDA
LRSSCEGIMVKSLDIDAGYSPSKRAETWLKVKRDYVDGLGDSLDLVPIGAWHGNGRKAGW
YSPFLMSCYNPDTEEFQSVCRVMSGFSDSFYIEMKEFFSGDKILSKKPPYYKTAEVPDMW
FSPEVVWEIRGADLTLSPVHQAAVGLVHPSRGISMRFPRFIRCVSDRNPEDCSTAADIAE
MFQSQSRKMDMSSTV
NT seq 4188 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctctgaaaccgccaccccgtcctcctccttcgactccgctcgcctcttcctc
gccgccaccggcacgccctccctccccctccctccgccgtcgccgcccccctccgacctc
cccgcctcgaagctcatccccggcacctgcttcctcgtcgacgccttccgcttcgccggc
gaccactccgtctcctacttcctctcccacttccactccgaccactacaccggcctctcc
ccggcctggtccaggggcgtcgtcttctgctcccccaccacctcccgcctcctgatcgac
gtcctcggcgtgcccgcgcggctcgtcgtgagcttgcccgtcggagaggcgctctcgatc
gatggctgcgaggtcaggctcgtggacgccaaccattgccccggcgcggtcatgttcctc
ttcaaagtcccgggaggcggcggcggcgagttccggaggtatgtgcacacgggcgatttt
cggtttcgggattcgatgagatcagagccggggttgggagagttcgtggcttgcgacgcg
attttcttggataccacgtattgtaatcctaaattcgtgttcccgtctcaggaagagagt
attgattacgtagctagtgtcatagagagagttggagttgaaaatagggattcggcgaag
aacattttgtttctcgtggcgacttatgtcatcgggaaagagcggattttgcttgaggta
gcgaggcggtgtggctgtaaggtgtacgtggatggtaggaagatggcggttttgcgtgct
ttggggtacagcgagagtggtgcatttacagaggatgaaagtgaaactgctgttcatgtt
gtcgggtggaatgtgttgggggagacatggccttattttcgacctaattttgttcagatg
aaggagcttattgtagagaaaggatataataaggttgtgggctttgtgcccactgggtgg
acttatgaagtgaagcgagacaagtttgctatcaggaagaaagattcattcgagattcat
ctcgtaccttatagtgagcattcgaactacaatgagctaagggagtttgtcaagttctta
aaaccaaagcgtgttattcctacagttggctcggacattgagaagcttgacggcaagcat
tttcatagagtgcagaagcttttcgcaggattgcttgatgagacagccaataagaaagag
ttcttgatgaatttcctcccatggtcctctgaaaaagagaacatagttgcaggagtagtt
gctactgcttcaaatgatgctttgatgcaagaaaaagagaagttatcgaaggaagatcac
agtgaaactttggatccaaaattttttttaggtgaaacaactgatcttaaaaaaggaggt
tttgaagagttagatttggtttcagaagagcgtgagaaagaaatcttacaggccctccag
gattgtcttcctgcatgggttactcgagatcagatgacaggcctaattaacagctcaggg
aggaatttggttgatgcagtttccaatttctatgaaaaggagactgaattctaccaacaa
gtttctgcttctgcttctgcttcttcttcttctttgcaggcatcctttatgagttcaagt
gatgtccattcatcaccttcagcaccagattctgtaaagggcagtgcctctggaacgaga
agtatgtttagcaaagactacaagttgccgaccgtgcaattaaccatgaccagcaagtct
cctggaaaaaagaagagaaatgttagtaatagccctaaaaagaagcagaagagcgcacca
aaaaaactggagtcaagtgggtcaggacaatctagaataacaaggtttttcactaaaagt
gtggccaacagtgctcaagatggtggacttgaagccaacttccagccatgctttaaagat
gataagttttcaagcccatataacgataaaatagatcaatttgttcaaattgtaaatggt
gatgattccttaagaagctatgctgccagcatcttggaaaaaacaaaaggagacatcgac
aaggctctggatgtatattatagcgatacagagagtagacctgtagacaataatgacatt
tcatttgtgtctctggcatcaggtcaatctgtcactgctagtgatggtaaattcaccgct
ggccacatcacgctgtcagagaaatcaggaagtgtggcagctatttcattggagcgtcca
ttagctgaaatatgcacagatttcgtgtcagttccacttgaaaagtataatcctgttgag
catgcttcctggagacttggagatcccgctccttatatacatcttgcgcggacttttgac
cttgttgaaagggaaaaaggcaagataaaagttacatccatgctttgcaacatgttcaga
agtttgttggctttgtcacctgaggatgttttacctgccacgtatctctgcacaaacaag
attgctcctgaccacgaaaatatggagctaaatattggtggaagcctggttgcagcagcc
attgaagatgtctgtggtgtgaaaaggtctaaaataagggatatgtacaacagattgggt
gatcttggtgatgttgcccaagaatgccgacaaacacaaacttttcttgcccctcctccg
gtgctgctgattaaagatgtattctctgtgctaaaaaaaataagtttccaaacagggagt
ggaagcaatgcccgcaaaaagagccttattgtgagtctcatgcgatcctgtagggagatg
gagatgaaatttattgtacgaaccttggttaggaatctaaggattggagccatgatgaga
actgttctgcctgcatttgctcaagctgttgtaatgaactcatctctagaagacacatcg
caaaagtcggagaaaattaagagcctatctgcctccatacttgaagcatataatgtactt
cctagtttggatttgattataccttctttaatgaaggaaggaattgaattttcttcatca
catttgtcaatgatccctggattgcctataaagccaatgcttgctaaaattaccgatgga
tgtccatcagtattgaaactctttgaaagtagggccttcacgtgtgaatataaatatgat
ggtcaacgtgctcagattcacaagctagctgatggatctatccgaattttttcaagaaat
ggagatgagacaacttctagatttccagatctgattgccatagttaatgaatcgtgtaag
ccttctgctgtgactttcatattggatgctgaggtagttgctgttgaccggaagagagga
agcaagctcatgtcttttcaggaactatcttcacgagagagaggaggtagagattctttg
gtttcattggatagcattaaggttgatatctgcatatttgtctttgacgttatgtttgca
aatggagagcaggtactgggtttccccctacgtgaaagacgtaaagtcttgcgggagctt
ttcaatgatgagaagaagggcttttttgaatatgttaaggaaatgactgtggatgccgag
gattctcatttggatagagaagatacattgactaggatgaacttgtttcttgaggatgct
ctccgttcttcatgtgaagggattatggtaaaatcattggacattgatgctggatattct
ccatcaaaacgtgctgaaacatggttgaaggtaaaacgggactatgtagacggattgggt
gactctctagatttagtcccaattggggcttggcatggtaatgggaggaaagcaggatgg
tacagtccattcctgatgtcatgttacaatcctgacacagaggagtttcaaagtgtatgt
cgtgtaatgtctgggttttctgattcattttacattgagatgaaagagttcttttcgggg
gacaagatcttgtccaagaagccaccttattacaaaacagcggaggtgcctgatatgtgg
ttctctccagaagtagtctgggaaattagaggtgcagacttaactctgtcacctgtccac
caggccgctgtaggtttagttcatccttctcgcggcatctctatgcgatttcccagattt
attaggtgtgtgtcagatagaaatccagaagattgcagcacagcagctgatatagctgag
atgtttcagtcacagagtaggaagatggacatgagctctacagtttga

DBGET integrated database retrieval system