KEGG   Eucalyptus grandis (rose gum): 104450033Help
Entry
104450033         CDS       T03547                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104450033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egr02000]
    104450033
Enzymes [BR:egr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104450033
Transporters [BR:egr02000]
 Other Transporters
  Pores ion channels [TC:1]
   104450033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_5 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 104450033
NCBI-ProteinID: XP_010062724
UniProt: A0A059BUR1
LinkDB All DBs
Position
Un
AA seq 278 aa AA seqDB search
MASASLWNVPELALTSLNRLIGNLLYIPNPILASPSNQKRPPQHIKLHYSSSTSLLKKQM
AEEVILLDFWPSPFGMRVRIALAEKGIAYDYKEEDLKNKSPLLLAMNPVHKKIPVLIHNG
KPVCESLIAVQYIDEVWHDKSPLLPSDPYERAQARFWADYVDKKIYDLGRKIWSTKGEEQ
EAAKKEFVESLKLLEGELGDKPFFGGQAFGFVDVALVPFYSWFYAYETCGGFSIEAECPK
LVAWAKRCLLRESVSKSLPDPEKVHGFVLELKKKYGVE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgcatctctctggaacgtcccagagcttgcattaactagtctaaaccgactt
ataggaaaccttctatatatacccaacccaattctggcgtctccctcaaatcagaagcga
cctccgcaacatattaagctgcattacagttcatcaacttctctcttgaagaaacaaatg
gctgaagaggtgattcttttggatttctggcccagcccatttgggatgagggtgagaatt
gctctggcggagaaagggatcgcctatgattacaaggaagaggacctgaagaacaagagc
cctctgctcctggcgatgaaccccgtccacaaaaaaatcccagtcctcatccacaatggg
aagcccgtctgcgagtctctcatcgcggttcagtatatcgacgaggtgtggcacgataag
tcgccgctgctgccgtccgatccttacgagagagctcaagcccgattctgggctgactac
gttgacaagaagatatatgaccttggacggaaaatatggtccacgaaaggagaggagcaa
gaggcggcgaagaaggagttcgtggagagcctcaagcttttggaaggggagcttggggac
aagcccttcttcggagggcaggcctttgggttcgtggacgtggctctcgtcccgttctac
agctggttctatgcgtacgagacttgcgggggtttcagcatcgaggccgagtgccccaag
ctcgttgcgtgggccaagaggtgcttgctccgagagagcgtgtccaagtcccttcctgac
cctgagaaagttcatgggttcgtgctggagctcaagaaaaagtatggggtcgagtga

DBGET integrated database retrieval system