KEGG   Eucalyptus grandis (rose gum): 104450544Help
Entry
104450544         CDS       T03547                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
egr  Eucalyptus grandis (rose gum)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 104450544
NCBI-ProteinID: XP_010063442
UniProt: A0A059BXH1
LinkDB All DBs
Position
Un
AA seq 1945 aa AA seqDB search
MTLGEVHVGSPGGGMADEARGDCTDSVDCVVAGKDADAGFADDGLTGAGADSGGGLSVSQ
GGGSGVGSFREAMATGCSYAENGEVDGDNVAGLRDERVNGLREVKRSTDDGMDPLTLGGE
DGSCDVNVSSMGCKMASEGVAGTVDYSTMPDESRAFPLSEKWTGSMVDEDVNSVIAEDYT
LGRISLCSEAGVMASANEVGSLDDLDLKDGQGVNGNAAVLSSEIRDAAAPACTQLSPSKS
FHETLEPSCSDDFPSSLLAEHYTLWPCQGRSEDGDMGVIGDPEPFYSSSMEIPDLGIAFA
ADDAEFTEEKLVVSRECDGQLDESAGSSSGKGALEFASQLTVADSYLLPSYLPSSTYTNC
SLKLKNVPEVSNGVIVPNSKVDNFKDGIDDGKCSTQSDHSSETTGPKIVSSSSQKSGRIS
KSGRKTQVKRAARNSRNASKVVCLLETREFVSEASKKKRTPLSKTARSSPWGALQNVSQL
FEQVNGLGFTQVKSQRRSKARTGRGSDKKKKDQQVSNPNLSNGTNCGSSTRIRLKVKLGK
GPILGSSNVIEVVESARSVSIVANTGATTSFKGTCAEVPQTDDGEYKSRVEGCLDNISSK
EKLVSADPRLSSGLETGNSDTGIILEKSTGNAREDCLGIPDCAEIETAGGTADGSYLDPE
TSPDSEVINLVPEAQDGEGFREDIDEAVLRRAQELATCENVDGSKRGKKKIKVPRRGNHA
MKDGLSGSTRSLKDKSSKKRGGRQNSSDCHLSKEDFTVSTMTNASIDCLSHSELLTSPVE
AGCAVPRAFQEVDNADRTFPEEDGSLGLSESENASILNCSTKSSGRKLSQNAKSSRVYKR
GSKSSNTTKSRKENGLSPLGKNKVKAEDIDNQALSQVKSPMKADCDIAGDQGNKIDSNAD
AGLVPISTPGSGTISGDSGDQHLLLRNAWVRCDDCYKWRRILAALADSIEDTNSHWTCKD
NTDVAFADCSIPQEKSNADINAELDISDASCEEDEGTARPNYKELGLSRLTVPQKSSFVR
IESNKFLHRSRRTQTIDEIMVCHCKPPSNGKSGCGDECLNRMLNIECVQGTCPCGDLCSN
QQFQKRKYAKMQWLRCGKKGYGLQVLEDVSKGGFIIEYVGEVLDMPAYKARQREYASQGH
KHFYFMTLNGSEVIDACAKGNLGRFINHSCDPNCRTEKWMVNGEICIGLFAIRDIKKGEE
VTFDYNYVRVFGAAAKKCVCGSPQCRGYIGGDPLNTDVIVQGDSDDEYPEPIMLFENGST
VHPLNQLGAQITSGYENSMDQSAADIGKSRTSEDNGDPNTNLPSSDLPVDIILQTNNDAS
ISVSATPQEIVAKEVLNASEKSEISSTSKPLSKLHRDDASRTRTKKSNTIDKRLHPLVKQ
SISSGSIKKSKDSGSSINMDKVQGTAHKSQMVFSKPRKAVEGSSGGRFEAVEEKLNELLD
SDGGISKRKDAPKGYLKLLFLTAASGDRGNEAIQSNRDLSMILDALLKTRSRVVLVDIIS
KNGLQMLHNIMKQYRRDFKKIPILRKLLKVLEYLAVREVLTLEHIASGPPCPGMESFRES
ILSLTEHDDKQVHQIARNFRDKWIPKPIRKFGFADRASASHNDWRDPGGRPTEAIDSFRQ
PMLATATVVTVSQDSGRASCAEDSSVNGKRIRKRKSRWDQDAEPITHPRISQHEEQVSEE
KRDCAGSVSLESSLGETVVADGSHQNSCEDVPPGFSSPPDTSRFSSNASSMAMDVSHENV
SHLHCPLNVVPGNPQGKFVSRLPVSYGIPLYFLQHLGKPQAESMESWIVAPGIPFHPFPP
LPQLPRERKRQSPAQNVDSQNAGHSADTAQVDECSQASFIDESSTGTSNSNLVDSEITCA
NSQQMCKRVKISSQDLGRRYFRQQKWNNTKVPPWLRKRNCWGYSVNNSKAGMCSIGLGNG
VNGQKNWDFSDDVNCKVRRDDGNYR
NT seq 5838 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgggcgaggtacacgtgggcagtccgggtggcgggatggcggatgaggcgaga
ggcgattgtacggattcggtcgattgcgtcgttgcggggaaggacgcggacgcgggcttc
gcggacgacggtttgaccggcgcgggtgccgattcgggcggcggtttgtcggtttcgcag
ggcggcggaagcggcgtcggttcgtttcgtgaagctatggcgaccggttgttcttacgca
gagaacggagaggtggatggtgataatgtggccggtcttcgggatgaaagagtcaacggc
ttgagggaagtgaagcggagtacggacgacggcatggatccgttgacgctgggaggagaa
gatgggagttgcgacgtaaacgtatcgtcgatgggttgtaaaatggcgtcggaaggggtc
gctggaaccgtggattattccacgatgccggacgagagccgtgccttccctctatcggag
aagtggacgggctccatggtcgacgaagatgtcaattcagttatagcggaggattatacg
cttggcagaatctcgttatgctcggaagctggtgtgatggcttctgccaacgaggtcggt
tcattggatgatttggacctgaaggatggccaaggcgtgaacggtaatgctgctgttctc
tcgagtgaaataagggatgctgctgcccctgcctgcacccagctatcgccttcaaaaagt
ttccatgaaacgttggaaccctcgtgttctgatgattttccgagtagtcttcttgcggag
cattacactttgtggccttgtcagggaaggagtgaggatggggatatgggcgttattggt
gatcctgaaccattttattcttcaagcatggaaatacctgatctaggcatcgcttttgct
gcagatgatgcagagttcacagaagagaaacttgtggtttcacgtgaatgtgatggacaa
ttggacgaaagtgctggcagcagttcagggaaaggggcattggaatttgcttctcagctc
actgttgcggattcgtatcttctgccgtcgtatctgccatcttcgacatacacaaactgc
tctttgaagctgaaaaatgtgccagaggtttcaaatggtgtcatcgttccaaactctaag
gttgacaattttaaggatggcatagatgatggaaaatgttctactcagtctgatcacagc
tctgagaccacaggccccaaaattgtatcatcctcctcccagaagagtggccggataagt
aaatcaggcaggaagactcaggtaaaaagggctgcaaggaactcgaggaatgcaagcaaa
gtagtatgccttctcgaaactcgagaatttgtcagtgaggcttccaaaaagaagaggacc
ccactctccaaaacagcccgttcttccccctggggtgcacttcaaaatgtttctcaactg
tttgagcaggtgaatgggctgggattcacgcaagtgaaaagccaaagacgaagtaaagct
aggactggcagaggaagtgataaaaagaaaaaggatcagcaagttagtaacccaaacttg
tccaatggaacaaattgtggttcatccacacgtatcaggttgaaggtaaaactgggcaaa
ggacccattctgggtagttcaaatgtaatagaggttgttgaatctgcccgatctgtaagc
attgttgccaatactggtgcaacgacatcgttcaagggaacctgtgccgaggttccccaa
acggacgatggtgaatacaaatcacgggtagagggatgtctagacaatatcagttcaaag
gaaaaacttgtttctgctgatcctcgcttaagttcaggtttggaaactggaaactcagac
actggtatcattttagaaaagtccactggaaatgctagagaagattgtcttggcattcct
gattgtgcagagattgaaacagcaggaggaactgctgatggcagttatttggatcctgaa
acttctcctgattcagaagtaattaatttagttccagaagcccaagatggtgaagggttt
agggaagacattgatgaagctgttttacgccgtgcccaagaattagccacttgcgaaaat
gttgatggctccaaaagaggaaaaaagaaaattaaggtgcctcgtcgaggtaatcatgct
atgaaagatggtttgtctggttcaacacgctcactcaaggataaatcttcaaagaaacgt
ggtggcagacaaaattcgagtgactgccatttatctaaagaggactttactgtatcaacc
atgactaatgcttccattgattgcttgagccatagtgaattgttaacttcaccagtggag
gctgggtgtgcagtgcctagagcttttcaggaagtggataatgctgataggacattccct
gaggaagatggaagtcttggactatctgaatctgaaaatgccagtatattaaattgctcc
accaagagttcgggacgtaaactttctcaaaatgcaaaatctagcagagtgtataagcgg
ggctctaaaagctccaatactacaaagagcaggaaggaaaacgggctaagccccttggga
aagaacaaggtaaaggctgaagacattgataatcaggccctgtctcaagtgaaaagtccc
atgaaagcagactgtgatatagccggtgaccagggtaacaaaattgactctaatgctgat
gctggattagtccctataagtacccctggatcagggacaatttcgggagattcaggggac
caacatttactgttgcgtaatgcttgggttcgttgtgatgattgctacaaatggagaagg
atactggctgcacttgcagattctattgaagatacaaatagccattggacctgtaaagac
aacacggatgtagctttcgccgactgttcaatccctcaagagaagtctaatgcagatata
aatgctgagttggacatatcagatgcttcttgtgaagaagacgagggcactgctcgtccc
aattataaagaattgggtttgagccgcttaacagtccctcagaaatcatcttttgttcgg
atagaatcaaataagtttctccaccggagcaggagaactcaaacaattgatgagataatg
gtttgccattgcaaaccaccttcaaatggtaagtcaggatgtggagatgaatgcctgaat
cgaatgctgaacattgaatgtgttcaaggtacctgcccttgtggggacctctgttcaaat
caacagttccagaaacgcaagtatgccaaaatgcaatggcttcgatgtggaaagaagggt
tatgggctgcaggtgctagaggatgtatccaaggggggatttataattgaatacgtagga
gaggtgcttgatatgcctgcatataaggcacggcaaagggagtatgcttcccagggtcat
aagcatttctattttatgacactgaatggtagcgaggttattgatgcgtgtgccaaaggg
aacttggggcggttcatcaaccacagctgtgatcccaattgccgaacagagaagtggatg
gtgaatggagaaatttgcattggattgtttgcaataagggatattaagaagggtgaagag
gttacatttgattacaactatgtaagggtgtttggtgctgcagctaaaaaatgcgtttgt
ggttcaccacaatgtcgaggttacataggtggcgatccacttaatactgatgtaattgtt
caaggtgattcggatgatgaatatccagaacccattatgcttttcgagaatggtagcaca
gttcatccattgaatcaattgggtgcgcaaatcacctcagggtatgagaattcaatggat
cagtctgctgctgatattgggaagtcacgaacatcagaagataatggggatccaaataca
aatctcccttcttccgatctgcctgttgatattattctacaaacaaataatgatgcaagt
atatctgtgtctgcaactccgcaagaaattgttgccaaggaggttctgaatgctagtgag
aaatctgaaatctcttctaccagcaagccgcttagcaaattacatcgtgatgacgcaagc
aggaccaggacaaagaagtccaatacaattgataaacggttacatcctcttgtgaaacaa
tccatatcatcaggctctatcaagaaaagtaaagacagtggtagttcaattaacatggac
aaagttcaggggactgcccacaagtcccagatggttttcagcaaacccagaaaagcagtt
gaaggatcttctggtggccggtttgaggcagttgaagagaaacttaatgagttgttggat
tctgatggtgggattagcaaaaggaaagatgctcctaagggttacttgaagctcctattt
ctcactgcagcttcaggtgatagaggcaacgaagcaatccagagcaaccgagatctttca
atgatccttgatgcacttctgaaaacaagatcccgagttgtactagttgatattataagc
aaaaatggtttgcagatgcttcacaacattatgaaacaatacaggagggattttaagaag
atccctatacttcgaaagcttctcaaggttctggagtatttagcagtgagggaggtcctt
acattggagcacatcgctagtggccctccttgtcctggaatggagagctttagggagtct
attttatcactgacggaacatgatgacaagcaggttcatcagattgcaaggaattttagg
gataaatggattcccaaacctatcaggaaatttggctttgctgacagggcttcggcatca
cataatgactggcgcgatccgggcgggagacctacagaagcaattgattcctttaggcaa
ccaatgcttgcaacagctacggttgtcactgttagtcaggatagtggcagagcatcatgt
gctgaagacagctcagttaatggtaaaaggatccgcaagcgcaagagccgctgggatcag
gatgcggagccaattacacatccaaggatctcacagcatgaggaacaagtctctgaagaa
aaaagagattgtgctgggtctgtcagcctcgagtcttctctcggggaaactgttgtggct
gatggaagtcatcagaacagctgtgaagatgttcctccaggattttcatctccccctgac
acatctagattttcttctaatgcttcatcaatggcgatggatgtctctcacgagaatgtt
tcccacttgcactgccctttaaatgtggtcccggggaatccacaggggaagtttgtttcc
cgtttgcctgtctcatatggaattcccttatattttctgcagcatttgggtaaacctcag
gctgaaagtatggagagttggattgttgctcctggcattcccttccatccttttcctcca
ttgccccaacttcctcgggagcggaagcgtcagtcacctgcacaaaatgttgattctcag
aacgctggccactctgctgacacagcacaggtggatgagtgcagtcaagctagtttcatt
gatgaaagcagcactgggacaagcaactctaacctagtagattcagagattacatgtgcc
aatagccagcaaatgtgtaagcgagtgaagatttcctctcaggatttgggtaggaggtac
ttcaggcaacagaaatggaacaatacaaaagttcccccttggcttcggaaaagaaactgc
tggggatactctgtaaacaactcaaaagctggaatgtgcagcataggtttaggaaatggt
gtgaacgggcagaagaattgggacttttcggatgatgtaaattgtaaagtgcggagggat
gatgggaattaccgctag

DBGET integrated database retrieval system