KEGG   Eucalyptus grandis (rose gum): 104453351Help
Entry
104453351         CDS       T03547                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104453351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egr03036]
    104453351
Enzymes [BR:egr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104453351
Chromosome and associated proteins [BR:egr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104453351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF682
Motif
Other DBs
NCBI-GeneID: 104453351
NCBI-ProteinID: XP_010066217
LinkDB All DBs
Position
Un
AA seq 365 aa AA seqDB search
MPVTKKNSECSQIGQVFGKLMKQMGTPKDFELPEWFTKEKPAPYSFIRRNIYLTKKMKRR
LDDDGIFCSCSPSPGSSVVCNKDCHCGMLLSSCSSGCKCGSSCINKPFQNRPMKKMKLVQ
TEKCGSGIVADEDIKQGEFVIEYVGEVIDDKTCEERLWNMKHRGETNFYLCEINRDMVID
ATYKGNKSRYINHSCCPNTEMQKWIIDGETRIGIFATRDIKKGEHLTYDYQFVQFGADQD
CHCGAVGCRRKLGVKPSKPKMCSEAALKLVACQVAVSPKLEGVLPRNDVCQNGGLHAGNS
RYIRCQRSPHNCVGEVIRITRPMNERTFGIIRRFDNFSRKHSIMFEDGAVEFLDMSKEDW
EFVTL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcactaagaagaattcagaatgtagccagatcgggcaagtgtttggcaagttg
atgaagcagatgggaactcctaaggactttgaacttccagaatggttcactaaggagaag
cccgcaccatacagttttataaggcgcaacatatatctcacaaagaagatgaagaggcgt
cttgacgatgatggcatattttgctcttgcagcccatctcctggttcttctgttgtgtgc
aataaagattgccattgtgggatgctgctctctagctgctcctcaggatgcaaatgtgga
agctcgtgcattaataaaccttttcaaaatcggccgatgaagaaaatgaaacttgtgcag
accgaaaaatgcggttctggaatagtagcagatgaagatatcaagcagggggagtttgtc
attgaatatgttggagaagtcattgatgacaaaacttgtgaagaaaggctttggaatatg
aaacatcggggtgaaacaaatttctacctgtgtgaaataaatcgagacatggtaattgat
gcgacatacaagggaaacaagtcgagatatatcaaccatagttgttgtcccaatactgag
atgcagaaatggataatcgatggtgaaacgagaattggtatttttgcgactcgcgacatc
aaaaagggcgagcatcttacctatgattaccagtttgtccagtttggtgcagatcaagat
tgtcactgtggcgctgtaggttgtaggagaaagcttggtgtcaagcctagcaagcctaag
atgtgttcagaagcagcgttgaagttagtggcatgccaggttgcagtttctcccaaattg
gagggagtcttacccagaaatgatgtttgccagaatggaggtctgcatgcaggaaattca
aggtacattcgctgtcaacgatctcctcacaactgcgtaggggaagtcatcagaattact
cgtccaatgaatgagaggacttttgggattatcagacgctttgataacttttccaggaaa
cattctataatgtttgaagatggtgctgtcgaatttcttgatatgtcaaaagaagattgg
gaatttgtgactttgtaa

DBGET integrated database retrieval system