KEGG   Eucalyptus grandis (rose gum): 104454243Help
Entry
104454243         CDS       T03547                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00564  Glycerophospholipid metabolism
egr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    104454243
Enzymes [BR:egr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     104454243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 GIDA FAD_binding_3 Lycopene_cycl HI0933_like NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 104454243
NCBI-ProteinID: XP_010067335
UniProt: A0A059BHW9
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MATTGTRLRRLAGIATAAAAAAAACTSLTPSVASSDRGGGPALDAVRRRIVDPSAAVPPP
RAVQESALVGASSANPLDILVIGGGATGCGVALDATTRGLRVGLVEREDFSSGTSSRSTK
LIHGGVRYLEKAVFNLDYGQLRLVFHALEERKQVIDNAPHLCHALPCMTPCFNWFEVVYY
WMGLKLYDLVAGARLLHLSRYYSAQESAELFPTLARKGKDRVLKGAVVYYDGQMNDSRLN
VGLACTAALAGAAVLNYAEVVSFLKDEVSDRIIGARIRDNLSGQEFDTYAKVVVNAAGPF
CDSVRKMAKVDAQPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAG
TTDSNTPITMLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLAVDPSAKNTES
ISRDHVVCEDYPGLVTITGGKWTTYRSMAEDAVNAAIRSGKLKPANECITNNLRLVGGEG
WDPAFFTVLAQQYVRMKRTYGGKVVPGVMDTAVAKHLSRAYGTFAERVAAIAQDEGLGKR
LAHGYPFLEAEVAYCARYEYCESAVDFIARRSRLAFLDTDAAGRALPQVIEILATEHQWD
KSRKKQELEKAKAFLETFKSSRNAQFHDGKHK
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccggcactcgcctccgccgcctcgccggcatcgccaccgccgccgccgcc
gccgccgccgcctgcacctccctgactccgtccgtcgcgtcctccgatcgcggcggcggc
cccgccctcgacgccgtgaggcggaggatcgtcgatcccagcgccgcggtcccgccgccg
cgagccgtccaggaatcggccctcgtcggcgccagctccgccaacccgctcgacattctc
gtgatcggcggcggcgcgaccggctgcggcgtcgctctcgacgccaccactcgcggactg
cgcgttggactcgttgagagagaggatttctcgtccggcacttcttctcggtcgacgaag
ctgatccatggaggggttcgataccttgaaaaggctgtgttcaatctcgactatgggcaa
ctgaggctagttttccatgcactcgaggagcgaaaacaggtcattgataatgccccacac
ctgtgccatgctttaccctgcatgacaccgtgctttaactggtttgaggttgtatactac
tggatgggcttgaaactatacgatttggtagcaggagcgcgccttttgcacttatctaga
tattattctgcacaagagtcagcggaacttttcccgactcttgcaaggaaaggcaaggac
cgagtactgaagggggcagtggtctactatgatgggcaaatgaatgactcgaggctcaat
gttggattagcatgtacggctgccctagctggcgcagcagttctcaactatgcagaagtg
gtttcctttcttaaggatgaagtcagtgatcgaataattggtgcaaggattcgagacaat
ttgtcaggccaagaatttgacacatatgcaaaagttgttgtcaatgctgccggcccattt
tgtgactctgtaaggaagatggctaaagtagatgcacagccaatgatctgtcccagcagt
ggtgtacacattgtcctccctgactactactctccagaaggcatgggcttgattgttcct
aaaactaaagatggaagagttgttttcatgcttccatggctggggagaactgtcgcgggc
actacagactctaacactccaatcacaatgctacctgaacctcatgaagatgagattcag
tttatacttgatgccatctgtgattatctcaatgtcaaggttagacgcacggatgttctc
tctgcgtggagtggtatccgtccattggcagtggatccctcagccaaaaacactgagagc
atatctagagatcatgttgtgtgtgaagattaccctggtttagtcaccatcacaggtgga
aagtggactacatatcggagcatggcagaagatgcagttaatgcagctatccggtctgga
aagctaaagccggccaatgaatgtattactaacaacctccgactggttgggggagaagga
tgggatcctgcattttttacagtgcttgctcagcaatatgtacggatgaaaaggacatat
ggtggtaaagttgttcctggggtgatggacactgccgtagccaagcatttgtctcgtgca
tatggaacttttgctgaaagagtggcagctatagctcaggatgaaggtttggggaagagg
ctggcacatggatatccttttctagaggctgaagtcgcgtactgtgctcggtacgagtac
tgtgaatctgctgttgattttatcgccaggagatcaagactcgctttcctcgacactgat
gcagccggccgggcactgcctcaagtcatcgagatacttgcgacagagcaccaatgggac
aagtcaaggaagaagcaagagctagagaaggcaaaagcatttttggaaactttcaaatcg
tctagaaacgcgcaatttcatgatgggaaacacaagtaa

DBGET integrated database retrieval system