KEGG   Eucalyptus grandis (rose gum): 104455709Help
Entry
104455709         CDS       T03547                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00010  Glycolysis / Gluconeogenesis
egr00020  Citrate cycle (TCA cycle)
egr00620  Pyruvate metabolism
egr01100  Metabolic pathways
egr01110  Biosynthesis of secondary metabolites
egr01200  Carbon metabolism
Module
egr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104455709
   00020 Citrate cycle (TCA cycle)
    104455709
   00620 Pyruvate metabolism
    104455709
Enzymes [BR:egr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104455709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 104455709
NCBI-ProteinID: XP_018715347
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MASSLLSPPSSSSSAAAAAAAISFSSSLSSAPLPRRPSSALPRRRGGRRSLSVQSKIREI
FMPALSSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDSILAAIVVPEGD
SAPVGAPIGLLAETEDEVAEAKAKAAAKSGSPSSPPSTAPAAAESPAVTSNPAPAIAQPP
PPRPAAPVDGPRKIVATPSAKKLAKQHKVDINKVTGTGPYGRITPADVEAAAGIQPSKPA
FTVTAAPAGAAEPAPAAAAAAAPPKSAAPAPPPLPGSTVVPFTTMQVAVSKNMVESLSVP
TFRVGYPVTTDVLDAFYEKVKPKGVTMTAILAKAAAMALVQHPVVNASCKDGKNFTYNSN
INIAVAVAINGGLITPVLQDADKLDLYLLSQKWKELVEKARSKQLQPHEYNSGTFTLSNL
GMFGVDRFDAILPPGQGAIMAVGASKPTVVADADGFFSVKSKMLVNVTADHRIIYGADLA
TFLQTFSKIVENPESLTL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttccctcctctctcctccctcctcctcctcctccgccgccgccgccgccgcc
gccatctccttctcctcctccctctcctccgcccctctcccccgccgcccctcctccgcc
ctcccccgccgccggggcggccggaggtccctgtccgtgcagtccaagatccgcgagatc
ttcatgcccgccctcagctccaccatgacggagggcaagatcgtgtcgtgggtcaagtcc
gagggcgacgtcctctccaagggcgagagcgtcgtggtcgtcgagtccgacaaggccgac
atggacgtcgagaccttctacgacagcatcctcgccgccatcgtcgtccccgagggcgac
agcgcccccgtcggcgcccccatcggcctcctcgccgagaccgaggacgaggtcgccgag
gccaaggccaaggccgccgccaagtcgggctctccctcgtctcctccttccaccgccccg
gcggcggccgagtcccccgccgtcacctcgaatcctgctccggcgattgctcagcctccg
ccgccgcggccggctgctccggtggatgggccgaggaagattgtggcgactccctccgcg
aagaagctcgccaagcagcacaaggtggacattaacaaggtgacaggtaccggtccgtac
gggaggatcacgccggcagacgtggaagcggctgctggaatccagccgtccaagccggcc
tttacagttactgctgctccagcgggtgcagcagagccagctccagctgctgctgcagct
gctgctccaccaaaatctgctgcccctgctccgcctccacttccaggatctacggtggtg
ccattcaccacaatgcaggtcgcggtgtcgaagaacatggtggagagtctctcggtaccg
acttttagagtcggataccctgtgacaactgatgtgctcgatgctttctacgagaaggtg
aaaccaaagggcgtgaccatgaccgctatattggcaaaggctgccgcaatggcacttgtt
cagcatccagttgtgaatgccagttgcaaagacgggaagaactttacttacaatagcaac
attaatattgctgttgcagtggccattaacggtgggttgatcacacctgtgcttcaggat
gcagataagttggatctatacttgctgtctcaaaaatggaaagagctggtggagaaagcc
cgctcaaagcaacttcagccacatgaatataactcaggcacatttactctttccaacctg
ggcatgtttggagtggacagatttgatgcaattcttcctccaggccagggggccatcatg
gctgtaggagcatcaaagccaactgttgtagctgatgctgatggattcttcagtgtcaaa
agtaaaatgctggtgaatgttacagcagatcacaggatcatctacggtgctgacttggcc
accttcctccagaccttctcaaagattgttgagaatcccgaaagccttacattgtaa

DBGET integrated database retrieval system