KEGG   Eucalyptus grandis (rose gum): 104457119Help
Entry
104457119         CDS       T03547                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
egr  Eucalyptus grandis (rose gum)
Pathway
egr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104457119
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egr03036]
    104457119
Enzymes [BR:egr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104457119
Chromosome and associated proteins [BR:egr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104457119
   Polycomb group proteins
    PRC2-EZH2 complex
     104457119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 104457119
NCBI-ProteinID: XP_010070361
UniProt: A0A059AYK9
LinkDB All DBs
Position
Unknown
AA seq 933 aa AA seqDB search
MASKAASSPSASANRLDAPADPSAPRPLETVPAVKEIANVIDGFKKEVAADRAVIIRKRI
EENRQELAGVTEKIFNSSKQRNDHTCDNIAGNSVDLLTKRQEDALGMQNGIDANNGDRDS
NDYLEDAHASTAVLLGSSIPVKNAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGR
RRIYYDQNGGEALICSDSEEEAIDEEEDKREFVDSEDFILRMTIKELGLSDSVLESLANC
LSRSPSELKARYEVLIKEEKDVGGSKNGDNEETSQTMSSFLDKDLDAALDSFDNLFCRRC
LVFDCRLHGCSQDLVLPVDKQPPWSHTDEENVPCGPRCYRSALKLVKGATVSSPGSGDPE
DKSNPSSNGSKSHVLTRKKSASSSDRSRLKQCQSESASSNAKNASESSDSETGPRQDGSA
RVLSPRKTKSAGKGGLRKRNSKRVAERVLVCLRKRQKMMASDSDSIASGSLLSGDMKLRS
KLQKENEDATSSSQKKLKCPVIGRPRRKDVTIEESHNLVQGEVPDAPSSEMTIDPPPANN
NDTSRKEEFVDENTCKQELSEDRSWKALEKGLYEKGLEIFGRNSCLIARNLLNGLKTCQE
IFQYMNCSENKLICQGGDAANYLGEGYPKFDSNGNVVHIEPRRRSRFLRRRGRVRRLKYT
WKSAAYHSIRKRITERKDQPCRQYNPCNCQTACGKQCSCLVNGTCCEKYCGCPKSCKNRF
RGCHCAKNQCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLL
KQQQRVLLGRSDVSGWGAFLKNSVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFN
LNDQFVLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERINAGEELFYDYRY
EPDRAPAWARKPEAAGSKKEEGAPSNGRAKKLA
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcggcgtcctcgccgtccgcctccgcgaacagattggacgccccggcg
gatccgtcggctccaaggccacttgaaacagtcccggctgtcaaggagatagcaaatgtt
attgatggtttcaagaaagaagttgctgctgatcgggctgttattataaggaaaagaatt
gaagaaaacagacaggagctggcaggtgttacagaaaaaatatttaattcgtctaagcaa
agaaatgatcatacatgcgacaacatcgctggtaatagtgtagacttactgacaaagagg
caagaagatgccctaggcatgcaaaatggtattgatgcaaacaatggcgatagagatagc
aatgactacctggaggatgctcatgcttctacggcagttcttcttggatctagtatccct
gtgaagaatgctgttcgcccgatcaagcttccagaagtgaaaagattacccccttacaca
acatggatttttctggacagaaatcagagaatgactgaggatcagtcagtcgtgggtcga
agaagaatatattatgatcagaatggcggggaagcacttatttgcagtgacagtgaagag
gaggcaattgatgaagaagaggacaagcgagagtttgtggattctgaagattttattctt
cgcatgaccatcaaagaacttggtttatctgattcagttttggaatcattggcaaattgt
ttatctagaagcccttctgaactcaaggcaagatatgaagtccttattaaggaagagaag
gatgtgggtggctctaagaatggggataatgaagaaacctctcagacaatgagttctttt
ctcgataaagatcttgatgctgctctagattcttttgataacctgttttgtcgtagatgt
cttgtttttgattgcagattgcatggatgttctcaggatcttgtgttacccgtggataaa
caacctccatggagccatactgatgaagaaaatgtaccatgtggtcctcgttgttacaga
tcggctttgaagttagtaaaaggtgcaacagtgagttctcctgggtctggtgatcctgaa
gataaatcaaatccttcatctaatggctccaagtctcatgttctaactaggaagaaatct
gccagctcatctgataggtcacggttgaaacaatgtcagagtgaaagtgcatcatctaat
gcaaaaaatgcctcagaaagcagcgattcagagacaggacccaggcaggatggttcagca
cgtgttttgtctcctcgcaagactaaaagtgccggaaaaggtggacttcgtaagaggaac
agcaagcgagttgctgagcgagttctagtttgcttgcgtaaacggcagaagatgatggct
tctgattcagattctattgcaagtggaagccttctatcaggagacatgaaactgagatcc
aaattgcagaaagagaatgaggatgctacttcttcttcacaaaagaaattaaagtgtcca
gtgattggcaggccaagaaggaaggatgtaactattgaggaaagtcacaacttagtacag
ggtgaagttcccgatgctccatcaagtgaaatgactatcgatccacctccggctaataat
aatgatacctcaagaaaagaagagtttgtcgacgaaaatacgtgtaaacaagaactaagt
gaggatagatcatggaaagctcttgagaaaggcctttatgagaaagggttggagattttt
ggtaggaacagctgtttgattgctaggaatctcttgaatggtttgaagacatgtcaggag
atttttcagtacatgaattgttctgagaacaagctaatatgtcaaggtggtgatgctgca
aattatctcggtgaaggctatcctaagtttgacagtaatggaaatgtggtccatattgaa
ccaagaagaagatcaagatttttgcgtaggagaggcagagtgcgtcgtctgaaatatact
tggaagtctgctgcctatcattcaatcaggaaaaggataactgagagaaaggatcagcca
tgccggcaatataacccatgtaactgccaaactgcatgtggcaagcagtgctcctgtctt
gtaaatggaacctgctgtgagaagtactgtggatgtccaaagagttgcaagaatcgattc
agaggctgtcattgtgccaaaaatcaatgtcggagccggcaatgtccatgttttgcagct
gacagggaatgcgatccagatgtttgccgaaattgttgggtcagttgtggtgatggaact
cttggcgtgcctaatcaaagaggtgataattatgaatgtaggaacatgaagctgcttctt
aagcaacaacaaagggttttgcttgggagatctgatgtatctggttggggagctttctta
aagaatagtgtcagcaaacacgaatatcttggcgaatatactggggagctaatttcacac
agggaagctgataagcggggaaagatttatgaccgtgaaaactcatcatttcttttcaat
ttgaatgatcagtttgttcttgatgcttatcgaaagggtgacaaattgaagtttgctaat
cactctcctgatcctaattgctatgctaaggttataatggtggcaggggaccatagggtg
gggatatttgccaaggaacgaatcaatgctggggaggagctattttatgactatcgttat
gaaccggaccgagcacctgcctgggcaaggaagcccgaggctgccggttctaaaaaggag
gaaggtgctccttcaaatggtcgggcaaagaagcttgcataa

DBGET integrated database retrieval system