KEGG   Elaeis guineensis (African oil palm): 105035588Help
Entry
105035588         CDS       T03921                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00010  Glycolysis / Gluconeogenesis
egu00020  Citrate cycle (TCA cycle)
egu00620  Pyruvate metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
Module
egu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105035588
   00020 Citrate cycle (TCA cycle)
    105035588
   00620 Pyruvate metabolism
    105035588
Enzymes [BR:egu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     105035588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 105035588
NCBI-ProteinID: XP_010909491
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MAANSSAAPFLSFSSSLSCPSPSRRLLPLPVRRGSPPLRRRIPAVQAKIREIFMPALSST
MTEGKIVSWVKAEGDRLSKGESVVVVESDKADMDVETFYDGILAAIVVPEGETAPVGAPI
GLLAESEDEVPLAKAQAQSQSQVQSHSSSPPSPPPPSDPTPSPAPTAAVKPEAEGPRKAV
ATPYAKKLAKQHRVDIEKVVGTGPHGRITPADVEAAAGIPPKKPIAPAPTSAPAATPVTP
SPAPTTATKASAAPLPPIPGSTVVPFTTMQTAVSKNMVESLSVPTFRVGYPVMTDALDAL
YEKIKSKGVTMTVLLAKAAAMALAQHPVINATCKDGKSFTYNSSINIAVAVAIDGGLITP
VLQDADKLDIYLLSQRWKELVSKARSKQLLPNEYNLGTFTLSNLGMFGVDRFDAILPPGQ
GAIMAVGASKPTVVADGDGFFTIKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESL
TV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaactcctccgccgcccccttcctctccttctcctcctccctctcctgcccc
tcccccagtcgccgcctcctccccctccccgtccgccgcggctcgccgcccctccgccgc
cggatcccggccgtccaggccaagatccgggagatcttcatgccggccctcagctccacc
atgacggagggtaagatcgtgtcctgggtcaaggccgagggcgaccgcctctccaaaggc
gaaagcgttgtcgtcgtcgagtccgacaaggccgacatggacgtcgagaccttctacgac
ggcatcctcgccgccatcgtcgtccccgaaggcgagacggcccccgtcggtgcccccatc
ggcctccttgccgagtccgaggatgaggtccccctcgccaaggcccaggcccagtcccag
tcgcaggtccagtcccactcctcttctcctccttctccccctcctccttccgatcccacc
ccttccccagctccgacggcagcggtgaaaccggaggcggagggcccgaggaaggccgtg
gccacgccctatgccaagaagctcgccaagcagcatagggtggacatcgagaaggtggtc
gggaccgggcctcacgggaggattactcctgccgatgtcgaggctgctgctgggatcccg
cccaagaagcctattgctccggctccaacttcagctcctgctgcgactccagttactcca
tcaccagctccaactactgccaccaaagcttctgcggctcctttgccaccaattccgggt
tcgactgttgttcccttcaccactatgcagacagctgtgtccaagaatatggtggagagc
ctctcagtgcctaccttccgtgtaggttatcctgtgatgaccgatgcccttgatgctctc
tatgaaaagatcaagtcgaagggagtcactatgaccgtactgttggccaaggctgcagca
atggcactcgcgcagcatccagtcatcaatgccacctgcaaggatgggaagagtttcact
tacaatagcagcattaacattgcagtggcggtagcaattgatggtggacttattactcct
gttctccaagacgcagataagttggatatttaccttctgtctcaaagatggaaggagctt
gtaagcaaggctcgttctaaacagcttttgcccaatgagtacaatttaggaacatttact
ttatcaaatttgggtatgtttggcgtggacaggtttgatgctatccttcctcccggtcag
ggagctatcatggctgtgggagcttcaaaacccactgttgttgctgatggagatggtttt
tttactattaagaataaaatgctggtgaatgtcacagcagaccaccggattatctatggt
gctgacttggcagccttcctacagacattttcaaagatcgttgagaatcctgaaagcctg
acagtgtag

DBGET integrated database retrieval system