KEGG   Elaeis guineensis (African oil palm): 105039198Help
Entry
105039198         CDS       T03921                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00010  Glycolysis / Gluconeogenesis
egu00053  Ascorbate and aldarate metabolism
egu00071  Fatty acid degradation
egu00280  Valine, leucine and isoleucine degradation
egu00310  Lysine degradation
egu00330  Arginine and proline metabolism
egu00340  Histidine metabolism
egu00380  Tryptophan metabolism
egu00410  beta-Alanine metabolism
egu00561  Glycerolipid metabolism
egu00620  Pyruvate metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105039198
   00053 Ascorbate and aldarate metabolism
    105039198
   00620 Pyruvate metabolism
    105039198
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105039198
   00561 Glycerolipid metabolism
    105039198
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105039198
   00310 Lysine degradation
    105039198
   00330 Arginine and proline metabolism
    105039198
   00340 Histidine metabolism
    105039198
   00380 Tryptophan metabolism
    105039198
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105039198
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    105039198
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105039198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 BMC
Motif
Other DBs
NCBI-GeneID: 105039198
NCBI-ProteinID: XP_010913576
LinkDB All DBs
Position
2
AA seq 543 aa AA seqDB search
MAAVRRLASSLLSRSLSASSRCSLTSPFRGDGTHASASGVLRRFSTAVAVEEPITPPVQV
HHTQLLINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDVEDVNHAVAAARKAFDEGPWPK
MTGYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAANAEVPMLVRLMRYYAGWADK
IHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAIVLKTAEQTP
LSALYVSKLLHEAGIPEGVLNVISGFGPTAGAALASHMEVDKLAFTGSTDTGKIVLELAA
RSNLKPVTLELGGKSPMIIMDDADVDHAVELAHMALFFNQGQCCCAGSRTFVHEKVYDEF
VEKAKARALKRVVGDPFRKGVEQGPQIDEEQFNKIMRYIKSGVDSGATLQAGGDRLGSKG
YFIQPTIFSDVKDGMPIAQEEIFGPVQSILKFSDLNEVIQRANTTRYGLAAGVFTNNLDT
ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGQGREKGIDSLKNYLQIKAVVTPLKNP
AWL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgcgaaggcttgcgtcctctcttctctcgcgctctctctccgcttcttcc
cgttgctctctcacctctccgtttcgcggagatggaacacatgcgtctgcatcgggggtt
cttcgaaggtttagcaccgcagttgcagttgaagaaccgatcacgccaccggttcaagta
caccacacacagcttctgatcaatgggcaattcgtagatgcagcatcaggtaagacattt
ccaacattagatcctaggactggggaagtgattgcccatgttgctgaaggagatgtggaa
gatgtcaaccatgctgttgctgctgctcgcaaggcatttgatgaaggaccatggccgaag
atgactggctacgaaaggtcacgcatacttttgcggttcgcagatttgatcgagaaacat
aatgatgagcttgcagcacttgagacttgggataatgggaaaccttatgaacaggctgcc
aatgcagaagttccaatgttggtccgtctaatgcgatattatgctggttgggcagataag
atacatggacttgttgtgccagctgatggtccgcatcatgtgcaagtcctgcacgagcca
attggtgttgcgggacagattatcccatggaactttccacttcttatgtttgcttggaag
gttggcccagcattagcatgtgggaacgccatagtattgaagaccgccgagcaaactcct
ctatctgctctttacgtgtccaaactgttgcatgaggctgggattcctgagggtgttttg
aatgtaatctctggatttggtccaactgctggtgcagctcttgccagtcacatggaggtt
gacaagcttgcttttactggatcaactgataccggcaagatcgtacttgaattggctgca
agaagcaaccttaagccagtgacattagagcttggtggcaagtcccctatgatcataatg
gatgatgccgatgtggaccatgcagtggaacttgcacatatggctttgttctttaatcag
ggacagtgctgttgtgctgggtctcgtacatttgtgcatgagaaggtgtatgatgagttt
gtggagaaagcaaaagcacgtgctttgaagcgtgttgttggtgaccctttcagaaaaggc
gttgaacaaggtcctcagatagacgaggagcagttcaacaagatcatgcgctacatcaaa
tctggtgttgacagtggggccactcttcaagcaggaggtgacagattaggcagcaagggt
tacttcattcagcctacgatcttttcagatgtgaaggatggaatgccaatagcacaagag
gagatctttgggccagttcaatcaatcttaaaattcagtgatcttaatgaggtcatacag
agggcaaacaccactcgctacgggctggcagctggagttttcaccaacaacctggacact
gccaacaccttgatgcgtgccctgagagctggaacagtatggatcaattgctttgatgtc
ttcgatgctgcgattccttttggtggctacaagatgagcgggcaaggaagagaaaagggc
atcgatagcctcaaaaactacttacagattaaggcagttgtgactccattgaagaaccct
gcatggttgtaa

DBGET integrated database retrieval system