KEGG   Elaeis guineensis (African oil palm): 105039440Help
Entry
105039440         CDS       T03921                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3B
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
egu  Elaeis guineensis (African oil palm)
Brite
KEGG Orthology (KO) [BR:egu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:egu03021]
    105039440
   03036 Chromosome and associated proteins [BR:egu03036]
    105039440
Transcription machinery [BR:egu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     105039440
Chromosome and associated proteins [BR:egu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    105039440
   PBAF complex
    105039440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM Myb_DNA-binding SWIRM-assoc_1 Myb_DNA-bind_6 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 105039440
NCBI-ProteinID: XP_010913882
LinkDB All DBs
Position
2
AA seq 475 aa AA seqDB search
MATPPPPAQTPGPLPANTPGPPQTPVLPVTPAVKSETPSTDVAELLPAASPRTPEPSPAA
SYTITIPSCSGWFSFGKIHETERKILPEFFDGKSVSRNPRVYKYYRDSIIRRFRRNPSRK
ITFTEGRRGLIGDVGSIRRVFDFLEEWGLINYAPSAKPSLKEKREAEEALEKKESPKKLC
SNCRSVCSIACFATDKADIILCARCFVRGNYRPGLSSTDFKRVDITEETKTDWTDKETLH
LLEAILHYGEDWKKVAEHVGGRSEKDCVARFIKLPFGEQFLGPPEIGEDGKQHEKNDQVS
AGHEEADAAMSRPIKRRHLTPLTDASNPIMAQVAFLSAMAGSDVVKAAAQAAISALYEVD
LASISSLNEAFCPNGQPVEEVVEEAATEAHSQLEKELQDVEQSVSDVVDVQMKDIQDKIA
HFEEVELQIERERLQLRYMKDLLFADHSTISQHKARLMFKGNDDLEKFRLDRNVT
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgcctccgccgcccgcccagacccccggcccgttgccggcgaatacccctggg
ccgccgcaaacccccgttcttccggtcacccccgctgttaaatctgagactccgtccacc
gacgtcgccgaactcctccctgccgccagtccccggacgccggaaccctcccccgcggcc
tcctacaccatcaccattcccagctgctccgggtggttttccttcggcaagatccacgag
acagagcgaaagatcctgccggagttcttcgacgggaagtcagtttcaagaaacccaagg
gtttacaagtactacagggactcgatcatcagacggttcaggagaaatccttcgaggaag
atcaccttcactgagggccggcgagggttgatcggggacgtagggtcgatccgaagggtg
tttgatttcctcgaggagtggggattgatcaattatgctccatcggcaaagcccagcttg
aaggagaagcgagaggctgaggaggctttagaaaagaaggagagccccaagaagctgtgc
agcaactgcaggtctgtctgtagcatcgcttgctttgccactgataaggcagacattatt
ctctgtgcaagatgctttgttcgtggcaactataggcctggcctcagttcaacagatttt
aaacgcgttgatatcactgaagaaacaaaaactgactggactgacaaagagactcttcac
ctacttgaggccattttgcactatggtgaagactggaaaaaggtggccgaacatgttggt
ggtagaagcgagaaagactgtgttgctagattcatcaagttgccttttggagagcagttc
ttggggcctccagaaattggggaagatggtaagcagcacgagaaaaatgatcaggtgagt
gctgggcatgaagaggcagatgctgcaatgtcacgccctataaagcgaaggcatctcaca
cccctaacagatgcaagcaacccaatcatggctcaggttgctttcttatctgccatggct
ggttcagatgtcgtcaaagctgcagctcaagctgccatttcagcattatatgaggtggac
ctggccagcatcagcagtttgaatgaggctttctgcccaaatggtcaacctgttgaagaa
gttgttgaagaggctgccacagaggcacattcacagcttgagaaggaactccaagatgtg
gagcaatctgtgtctgacgttgtggatgttcagatgaaagatatccaggataagattgca
cattttgaggaggttgaattgcagattgagagagagcggctgcaactgcggtacatgaag
gatctactatttgctgatcactcaacaatttctcagcacaaggctcggctaatgtttaag
ggaaatgatgatttggagaagtttagacttgatcgcaatgtaacttga

DBGET integrated database retrieval system