KEGG   Elaeis guineensis (African oil palm): 105040386Help
Entry
105040386         CDS       T03921                                 

Definition
(RefSeq) hexokinase-2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00010  Glycolysis / Gluconeogenesis
egu00051  Fructose and mannose metabolism
egu00052  Galactose metabolism
egu00500  Starch and sucrose metabolism
egu00520  Amino sugar and nucleotide sugar metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
Module
egu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
egu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105040386
   00051 Fructose and mannose metabolism
    105040386
   00052 Galactose metabolism
    105040386
   00500 Starch and sucrose metabolism
    105040386
   00520 Amino sugar and nucleotide sugar metabolism
    105040386
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105040386
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egu04131]
    105040386
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105040386
Membrane trafficking [BR:egu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105040386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Porphobil_deamC
Motif
Other DBs
NCBI-GeneID: 105040386
NCBI-ProteinID: XP_010915190
LinkDB All DBs
Position
1
AA seq 500 aa AA seqDB search
MGKVAVGAAVVCAAAACAVAALVVRHRMRSSGRWARAVAILKELEEKCATPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGH
VVKQEFEEVSIPPNLMVGRSSELFDFIAAELAKFVASEGEEFHLPAGRQRELGFTFSFPV
KQTSISSGTLIKWTKGFAIDGTVGEDVVAELTKAMERQGLDMRVSALVNDTIGTLAGGRY
YDNDVVAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDQ
ALDLESLNPGEQIFEKLISGMYLGELVRRVLLKMAEEAALFGDSVPPKLEIQFILRTPDM
SAMHHDTSSDLRVVGTKLKEILGISNTSLKTRKLVVEVCDIIAKRGARLAAAGILGVLKK
QGRDSAARDGGEMQRTVIAMDGGLYEHYTIFSNCLETTLKEMIGEEAAASIVIKLATDGS
GIGAALLAASHSQYLELEES
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcagtgggagcggcggtggtgtgcgcggcggcggcatgcgcggtggcg
gcgctggtggtgcggcataggatgcggagctccgggcggtgggcgcgggcggtggcgata
ctgaaggaactggaggagaagtgcgccacgccgatcgggaagctgaggcaggtggcggat
gcgatgacggtggagatgcacgccgggctcgcgtcagagggtgggagcaagctcaagatg
ctcatcagctatgtcgataacctccccactggggatgagacaggattgttttacgcattg
gaccttgggggaaccaacttccgtgtgttacgcgtacaattgggaggaaaggaagggcat
gttgtcaagcaagagtttgaagaagtttccattccacctaatttaatggttggacgctcc
agtgaactatttgacttcattgctgcagaattagcaaagtttgttgcttcagaaggtgag
gaatttcaccttcctgcgggtaggcagcgagaacttggttttactttctctttcccagtg
aagcaaacttcaatctcatcaggcactcttattaagtggacaaagggtttcgccattgat
ggcacggttggggaagatgtggtggcggagttgaccaaggccatggaaaggcaaggcctt
gatatgcgagtttcagcactggtaaacgacacaattgggacattggcagggggcagatac
tatgataatgatgtggttgctgctgtcatactgggtactggaacaaatgcggcatatgta
gagcgtgcacatgcaattcctaaatggcatggccttttaccaaaatcaggagagatggtt
atcaacatggaatggggaaatttcaggtcgtctcatcttcctcttacagaatatgatcaa
gcattagatcttgaaagtctgaatcctggtgaacagatctttgagaagttaatctcggga
atgtacttgggagaacttgtgcgaagagtcctgttgaagatggccgaagaagcagccttg
tttggagacagcgttccaccaaaacttgaaattcaatttatactacggactccggacatg
tcagccatgcatcatgacacatcatccgatctcagggttgttgggaccaaactaaaagaa
atattagggatatctaatacctccttgaaaactagaaaactagttgttgaggtctgtgac
atcatcgctaaacgtggggcacgtctggctgctgctggaatactgggtgtcttgaagaag
caggggcgggacagtgcagcaagggatggaggtgagatgcagaggacagtgattgctatg
gatggtgggctttacgagcattacactatatttagcaattgcttggaaactacacttaaa
gagatgatcggcgaagaggccgcagcttctattgtcatcaagcttgccaccgacggctca
ggcattggagcagcacttctcgctgcatcccactctcagtatcttgagcttgaagaatcc
tga

DBGET integrated database retrieval system