KEGG   Elaeis guineensis (African oil palm): 105042280Help
Entry
105042280         CDS       T03921                                 

Definition
(RefSeq) short-chain type dehydrogenase/reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00061  Fatty acid biosynthesis
egu00780  Biotin metabolism
egu01100  Metabolic pathways
egu01212  Fatty acid metabolism
Module
egu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105042280
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    105042280
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    105042280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egu01004]
    105042280
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     105042280
Lipid biosynthesis proteins [BR:egu01004]
 Fatty acid synthase
  Component type
   105042280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase F420_oxidored Polysacc_synt_2 GDP_Man_Dehyd NAD_binding_10 3Beta_HSD
Motif
Other DBs
NCBI-GeneID: 105042280
NCBI-ProteinID: XP_010917717
LinkDB All DBs
Position
3
AA seq 302 aa AA seqDB search
MASPSNFSGEPSNNAGSPPSSDLASERDGYPTSLVHGSGGLYGTTSSLPLKDRVAIITGG
SGGIGTAITTHLASLGAKVVIAYVGDPTPADSLASTLNNSTTANSGPRAIAVEADISKEE
QVKHLFDKAQSTFGPTIHILVAAAGVQDPKYPPLAETTLQQWEWVYNINAKGTFLCCREA
ANRLVRGGGGRIITMSSSTVGSLRPGYSTYSSTKGAIEVMTKILAKELKGTGITANAVAP
GPIATPLFYAGKSEERIRKVAAESPMGRLGTPEDVAPMVGFLASDAGEWVNGQIIRLNGG
YV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccctcaaacttttccggcgaaccaagcaacaacgccggctcgccgccctca
tcggacttggccagtgaacgagatggatatcctacgagcctagtccatggatcaggtggc
ctctatggtactacaagctcactaccgcttaaggaccgggtggccatcataacaggcggc
tccggcggcatcggaactgcgatcaccacccacctagcctccctcggtgccaaggtagtc
atcgcctatgtcggcgaccctacgccggccgacagccttgcctccaccctcaacaactcc
accactgccaattccggcccacgggccattgcagtcgaagcggatatctcaaaagaagag
caagtgaagcatctcttcgacaaggcccagtccactttcggcccaacaatccacatcctt
gtggctgctgctggtgtccaagaccccaagtacccaccacttgctgagacaacattacag
caatgggagtgggtgtacaacatcaacgccaaggggacgttcctttgctgccgggaggcg
gcgaaccggctggttcgaggtggcggaggaagaattataacgatgtcgtcatcgaccgtg
ggctccttgaggcctggctatagcacgtactcatcgaccaagggtgcgatcgaggtgatg
acgaagatcctagcgaaggagctgaagggaaccgggatcacggcgaatgcggtggcgccg
gggccaattgcgacgccgttgttctatgccgggaaatcggaggagcggataaggaaggtg
gcggccgagagcccaatgggccggctgggtacgcctgaagatgtggcccctatggtgggg
ttcttggcaagtgatgccggggagtgggtcaatggccagatcatccgtctgaatggtgga
tatgtttga

DBGET integrated database retrieval system