KEGG   Elaeis guineensis (African oil palm): 105047098Help
Entry
105047098         CDS       T03921                                 

Definition
(RefSeq) DNA ligase 6 isoform X4
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03030  DNA replication
egu03410  Base excision repair
egu03420  Nucleotide excision repair
egu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105047098
   03410 Base excision repair
    105047098
   03420 Nucleotide excision repair
    105047098
   03430 Mismatch repair
    105047098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egu03032]
    105047098
   03400 DNA repair and recombination proteins [BR:egu03400]
    105047098
Enzymes [BR:egu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105047098
    6.5.1.6  DNA ligase (ATP or NAD+)
     105047098
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105047098
DNA replication proteins [BR:egu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105047098
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105047098
DNA repair and recombination proteins [BR:egu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105047098
   NER (nucleotide excision repair)
    Other NER factors
     105047098
   MMR (mismatch excision repair)
    Other MMR factors
     105047098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL UBA_4 RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 105047098
NCBI-ProteinID: XP_010924208
LinkDB All DBs
Position
1
AA seq 1405 aa AA seqDB search
MATLSSSTTKTRTLTSSSVFLDSYRSSSNLSAPTAPSLAFDLLSRGSPLPPIPPDFPHSK
LIPSTRFIVDGFRSAGDFSVSYFLSHFHSDHYAGLSPSWSKGLIICSETTARLVVEILNV
LPFFVVSLSLGETAEIDGWDVTAVDANHCPGAVQFLFKAHGSEGHRPERYVHTGDFRFCD
SMKLDPTLCEFIGADAVFLDTTYCNPKYTFPSQEESVEYVVSTIKRIRDQNKGPRETILF
LIATYVVGKEKILLEISRRCDCLLHVDSRKMGILSVLGFGDSGVFTEDISASNIHVIGWN
LLGETWPYFRPNFVKMKELMTERGYSKAVGFVSTGWMYETKKDGFAVRIKESLEIHLVPY
SEHSNYHELREYVRFLRPKRVIPTVGMDVEKLDGKHAIALQKHFAGLVDETANKHEFLMA
FHQKLGDADTMAGNDVVTNTSKQDSAEGKENSYLEPLQSGERSHLQDPNMSNDEDMAEVI
NELKDCLPSWVTQNQILGLLKSSDGDIVGAASHFFEHETEFYEQAKVVTASVPRNQNSCT
EIESFPAQKSIQGHSTCDLKDYLDNAKTPTRQKPTSLSSNLPKKRGAGTGNKPSKKGKSS
SGLESSGCKQTTITKFFGRLEAHASYGDGPCTVTADYHLENGNQTLTDADETYKNELDLF
LQIIDGGMQRDSAALLLEKTKGNIDVAVDMYFSGSKLVSGTKESLFSCSAHVDKDESLAS
GCTSKANISFEATINLPTLFVQGSSAEDTTVTNVSLPIEKYSPVEYACWKAGQPAPYLHL
ARTFDLVEREKGKIKTTVMLCNMFRSLLSLSPDDVLPAVYLCTNRIAPDHENMELNIGGS
LVITALEEACGTSRSRIKEMYKTSGDFGDVAQECRQTQSLLAPPCPLSIHNLFYVLRKIS
VTTGAGSAVQRKNLVVNLMRSCREMEIKFLVRTLVRNLRIGAMMKTILPALAQAVVLNSY
TPMQDIGSVGSQKLQLQGISAAVTEAYNILPNLDLLIPSLLSKGIDFSASTLTMVPGTPI
HPMLARITNGVSQVLKLFQGRSFTCEYKYDGQRAQIHKLADGSIRVFSRQMKESTSRFPD
LIHIIKEMYKPEISTFILDAEVVAVDRKNGCKLMSFQELSSRERGSKDSSITMNSIKVDI
CIFIFDIMFSNGERLLEYPLRQRRKCIKDLFHNEKMGYLEFAREITVEAEEAFLSNQNTL
TKINSFFEDACTSSCEGIMVKTLDVDAGYFASKRSEAWLKVKRDYVEGLGDCLDLVPIGA
WHGNGRKAGWYSPCLMACYNPDAEEFQSVCRVMSGFSDSFYKEMKEYFSGEKILSKKPPY
YQTDDSPDLWFPPELVWEIRGADLTISPVHHAAVGLVHPSRGISVRLPRYVRPVLDRKPE
NCSTSADIACMFKSQTRRMEVSKED
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggccactctctcgtcgtccaccaccaaaactcgaactctaacctcctcctccgtcttc
ctcgactcctaccgatcctcctccaacctctccgctcccaccgccccttccctcgccttc
gatctcctctcccgtggctcccctcttcctccgatccctcctgacttcccccactctaag
ctcatccccagtacccgcttcatcgtcgacggattccgctccgccggcgatttctccgtc
tcctacttcctctcccacttccactccgaccactacgccggcctgagccctagctggtcc
aaaggcctcatcatttgctccgagaccaccgcccgtctcgttgtggagatcctcaatgtc
ctccctttcttcgtagtctccctttctcttggcgagactgcggagattgatggatgggat
gtcacagcggtcgatgcgaaccactgcccaggtgctgtccagttccttttcaaggcccac
ggatcagagggacaccggccagagaggtatgtccacactggcgatttccgtttctgtgat
tcgatgaaattggatcccactttatgtgaatttattggtgccgatgctgttttcttggat
acaacatactgcaatccgaaatatacgtttccttctcaggaggaatcagtggagtatgtg
gtgagcactatcaaaagaattagagatcaaaataaaggaccacgggagactatcctgttc
ctcattgctacttatgttgtgggaaaagagaagattttgctcgagatatcacgccggtgt
gactgcttattacatgtagatagtaggaagatggggattttgtctgtattagggtttggc
gactctggggtttttaccgaggatatttctgctagtaacattcatgtgattggttggaac
ctactgggggaaacttggccatacttccgacccaattttgtgaagatgaaggagcttatg
acagagagagggtattcaaaggcggttggctttgtttcgactgggtggatgtatgaaaca
aagaaagatggttttgcagtgagaataaaggaatcacttgagattcatctcgttccgtac
agtgaacattcaaactatcatgaattaagggagtatgttaggttcttaaggccaaagcgt
gttattcccactgtgggcatggatgttgagaaactagatggtaaacatgctattgctttg
cagaagcattttgcaggtttggttgatgaaacagcaaacaagcatgagtttctcatggct
ttccatcagaagctgggggatgctgatactatggctggaaatgatgtggtaactaataca
agcaagcaagacagtgcagaaggaaaggagaattcatatctggagccattgcagtctggg
gagagatctcacctccaagatccaaatatgtcaaatgatgaagacatggctgaagtcatc
aacgagcttaaagattgcttgccatcttgggtgactcagaatcagattttaggtttgctg
aaaagctcagatggagatattgttggagcagcttcacatttttttgagcatgaaactgag
ttctatgagcaagcaaaggttgttactgcttcagtacccagaaatcaaaacagttgcact
gaaattgaatcttttcctgctcagaaatctattcaagggcattccacatgtgatttaaag
gattatttggataatgctaaaacaccaaccaggcagaaacctacatcattgagttctaat
ttgcccaagaaaaggggtgcaggtactggaaataagccaagcaagaaaggaaagtctagc
tcaggcttagaatccagtggatgcaagcagactacaatcacaaaattttttggaagactt
gaagctcatgcttcttatggtgatggaccttgtacagttactgctgattatcatttggaa
aatgggaatcaaacacttactgatgctgatgaaacatacaaaaacgagttggatctgttt
cttcaaataatagatggtggtatgcagagagactctgctgccttattactcgagaagaca
aaaggaaacattgatgtagcagtcgatatgtatttcagtggttctaagcttgtatctggt
accaaggaaagtttattttcttgcagtgcacatgttgacaaggatgagagccttgctagt
ggttgtacttcaaaggccaacatttcttttgaggcaacaataaacttgcctactttgttt
gtccaaggttcttcggcagaggacacaactgtaactaatgtatcattaccaattgaaaag
tattctcctgttgagtatgcttgctggaaggctggacagcctgctccctacttgcacctg
gcacgtacatttgatttggtggaacgagaaaagggcaaaataaaaaccactgtgatgctt
tgcaacatgttcagaagcttgctttctttgtctcctgatgatgtgctacctgctgtgtac
ctatgcacaaacagaattgctcctgaccatgaaaacatggaactgaacattggtggcagt
ctggtcataactgcactggaagaggcttgtgggacaagcaggtctagaattaaagaaatg
tacaaaacttctggtgattttggtgatgttgcacaagagtgccggcagactcaatcgttg
cttgctcctccttgccctctttctattcataatttattttatgtgcttcggaagataagt
gttacaaccggagctggaagtgctgttcaaagaaaaaatcttgtcgtaaatcttatgcgt
tcttgtagagaaatggaaataaagtttctagttagaactttggttcgtaatttgcgtatt
ggagctatgatgaaaaccattttaccagcactagcacaagctgtggtgttgaacagctac
actccaatgcaagacatagggtccgtggggagccaaaaattgcagcttcagggcatatct
gcagctgttacggaggcctacaatatacttccaaatttggatttgcttattccttcactt
ttgagcaagggcattgatttttcagcatccactttaacaatggtgccaggcacaccaatt
catcctatgcttgccagaattaccaatggtgtttcacaagtgctgaaattatttcagggt
cgatctttcacctgtgaatacaaatatgatggtcaacgtgcccaaattcacaaactagca
gatggatctatacgagtattttcacgacaaatgaaagaatcaacatctagattccctgat
ttgatacatataattaaagaaatgtataagcctgaaatctcaactttcatactggatgct
gaggttgtagcagttgataggaagaatggttgcaagcttatgtctttccaagagctgtca
tcacgggagagaggaagtaaagattcctcaatcacaatgaacagcattaaggttgatatt
tgcatcttcatctttgatatcatgttttctaatggggagcggctgttggagtatccactt
cgtcaaaggaggaagtgtataaaagatttgtttcacaatgaaaagatgggctacctggaa
tttgcaagagaaataacggtggaagcagaagaagcatttctgagtaatcaaaacactctg
actaagataaactcattttttgaagatgcatgtacctcctcatgtgaaggaataatggtg
aaaactttggatgttgatgctggatattttgcatcgaaacgtagtgaggcctggctaaaa
gtgaaacgtgactatgtagaaggactaggtgattgtcttgatttagtacctattggtgct
tggcatgggaatggaagaaaagcaggatggtacagtccttgtctaatggcatgctacaat
cctgatgctgaagaatttcaaagtgtgtgtcgtgtgatgtcaggtttctcagattctttc
tataaagagatgaaggaatatttctctggtgaaaagattttgtccaagaagccaccttac
tatcagacagatgactcacctgatctatggttccctcctgagcttgtctgggaaatacgg
ggcgcagaccttacaatctctccagtgcaccatgctgctgttggcttagttcatccatct
cgaggtatctcggtgagactaccgaggtatgtgcgtcctgtattggaccgaaagccagaa
aattgcagcacgtcagctgatattgcctgcatgtttaagtctcagactagaaggatggag
gtgagcaaggaagactga

DBGET integrated database retrieval system