KEGG   Elaeis guineensis (African oil palm): 105047390Help
Entry
105047390         CDS       T03921                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00620  Pyruvate metabolism
egu00710  Carbon fixation in photosynthetic organisms
egu01100  Metabolic pathways
egu01200  Carbon metabolism
Module
egu_M00168  CAM (Crassulacean acid metabolism), dark
egu_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
egu_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
egu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    105047390
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105047390
Enzymes [BR:egu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     105047390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 105047390
NCBI-ProteinID: XP_010924612
LinkDB All DBs
Position
6
AA seq 966 aa AA seqDB search
MSRNAVEKLASIDAQLRLLAPRKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKHDPRKLDELGDVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK
LKKGYFADENCATTESDIEETLKRLVVQLKKSPAEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRIQADELHRSSKKDAAKHYIEFWKQV
PPNEPYRVILSDVRDKLYNTRERSRHLLSNGYSDIPEEATFTNVEQFLEPLELCYRSLCA
CGDRPIADGSLLDFLRQVSIFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEEK
RQEWLLSELNGKRPLFGPDLPKTEEIADVLDTFHVIAELPSDNFGAYIISMATAPSDVLA
VELLQRECHVKKPLRVVPLFEKLADLEAAPAALARLFSIDWYRNRINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPISPKPEWRALMDEMAVVAT
REYRSIVFEEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHVMEKDIKNLHMLQVMYNEWPFFRVTIDLVEMVFAKGNPGIAALYD
KLLVSEELWPFGDRLRANYEETKQLLLQVAGHKGLLEGDPYLKQRIRLRDAYITTLNVCQ
AYTLKQIRDPSYHVKVRPHLSKEIMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggaacgcggtggagaagctggcctcgattgatgcgcagctgaggcttctggcg
ccgcggaaggtgtcggaagatgataagctggtcgaatatgatgcgctcctcttggatcgg
tttcttgatattctccaggatttgcatggcgaggatatcagggaaacggtccaagagtgt
tatgagctatcggcagagtatgaagggaagcatgatcctaggaagctggatgagctgggg
gatgtgctgacaagtttggatccaggtgactccatcgtggtcaccaagtcattctcacac
atgcttaacttggccaacttggctgaggaggtccagattgcctaccgtaggagaatcaag
ctgaaaaagggatattttgctgatgaaaattgtgcaactactgaatcagacattgaagag
acccttaaaaggctcgtggtgcagctgaagaagtccccagcagaggtctttgatgctttg
aagaaccagacagttgatctggttttgactgcacacccgactcagtcagtcaggagatca
ctgctccaaaagcatgcaaggataaggaattgtttggcacaattgtatgcgaaggatatt
actcctgatgacaagcaggagcttgatgaggctcttcagagggagattcaagctgccttt
agaacagatgagatacgaagaactcctcccactcctcaagatgaaatgcgggctggaatg
agctattttcatgagacaatatggaaaggtgtcccaaagttcttacgtcgggttgataca
gctctgaaaaacattggaataaatgaacgtgtgccttataatgcccctcttattcagttt
tcttcttggatgggtggggatcgtgatggaaatcctagagtgactccagaagtaacaagg
gatgtatgcttgttggctcgaatgatggctgcaaatctgtactattcccaaatagaagat
ctaatgtttgagctttctatgtggcgctgcaatgatgaactccgaatacaggcggatgag
ctgcaccgctcctccaaaaaagatgctgcaaaacattatatagagttttggaaacaagtt
cctccaaatgagccttaccgtgttatacttagtgatgtcagagataagctatacaataca
cgtgagcggtcccgccatttattgtcgaatggatattcagatatccctgaggaagcaact
ttcaccaatgttgaacagttcctggagcctcttgagctatgttacagatctctctgtgct
tgtggtgatagaccaattgctgatggaagccttcttgactttttgcgccaagtatcgata
tttggcctgtcacttgtgagacttgatatcaggcaagaatctgacaggcacactgatgtt
attgatgctatcaccaagcatctagaaattggatcataccgtgagtggtcagaagaaaaa
cgccaggaatggctgttgtctgaacttaatggaaagcgtccgttgtttggtcctgacctt
cctaaaactgaggaaatagctgatgttttagatacattccacgtaattgcagaacttcct
tcagacaattttggggcatatatcatctcgatggcaactgctccatcagatgtcctggct
gttgagctgctgcagcgtgagtgccatgtgaagaaacctctgagagttgtccctctattt
gagaaacttgcggatcttgaggcagcccctgctgctttagcccggctattttcaatagac
tggtacaggaaccggattaatggtaaacaggaagtcatgattggatattcagattcaggg
aaagatgctgggcgcctttctgcagcttggcagttatacaaagctcaggaagagcttata
aaggttgccaagcaatatggagtgaaattgacaatgttccatgggcgaggagggactgtt
ggaagaggaggtggtccaactcatcttgctatattatctcagccaccagacacaatccat
ggatcactccgagtcacggttcaaggtgaagttattgagcagtcatttggagaggagcat
ttgtgcttcagaacactccaacgattcacagctgctactcttgaacatggaatgcatccc
cctatttctccaaagccagaatggcgtgcactgatggatgagatggctgttgtagccaca
agggaataccgatcaattgtattcgaagaaccacgtttcgttgaatatttccgcctggca
actccggagcttgagtatggtaggatgaacattggcagtaggccatcaaaacgaaagcct
agtgggggcatagaatcactacgtgcaatcccatggatctttgcatggacacagacacgt
tttcatcttccagtatggcttggctttggtgcagcatttaagcatgtcatggaaaaagat
atcaagaatcttcacatgcttcaggtgatgtacaacgagtggccatttttcagggtcact
attgacttggttgagatggttttcgccaagggaaatcctggcatagctgctttatatgac
aaattgcttgtgtcagaagaattatggccatttggtgaccgactaagagccaactacgaa
gaaacaaagcaacttcttcttcaggttgctggtcacaaaggtctcctcgaaggggatcca
tacttgaaacagagaatacgcctgcgtgatgcatatatcacaactctgaatgtttgccaa
gcttataccctgaagcagattagagaccccagttaccatgtgaaggtgagaccgcatctg
tcaaaggagataatggagtctagcaagccagctgcagaattggtgaagttaaaccccaca
agcgagtatgcccctgggctggaggataccctcattctgaccatgaagggtatagctgct
ggcatgcagaacactggctaa

DBGET integrated database retrieval system