KEGG   Elaeis guineensis (African oil palm): 105048019Help
Entry
105048019         CDS       T03921                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 3 isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00010  Glycolysis / Gluconeogenesis
egu00030  Pentose phosphate pathway
egu00051  Fructose and mannose metabolism
egu00052  Galactose metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
egu01230  Biosynthesis of amino acids
egu03018  RNA degradation
Module
egu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105048019
   00030 Pentose phosphate pathway
    105048019
   00051 Fructose and mannose metabolism
    105048019
   00052 Galactose metabolism
    105048019
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105048019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egu01009]
    105048019
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:egu03019]
    105048019
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105048019
Protein phosphatases and associated proteins [BR:egu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105048019
Messenger RNA biogenesis [BR:egu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105048019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 105048019
NCBI-ProteinID: XP_010925503
LinkDB All DBs
Position
7
AA seq 552 aa AA seqDB search
MESVPNSTPVPQKLHVGSNGIIPNSNHFLDLRSSLSSVEAPGRNGDPKLQSGRKMGLEIK
TNPKIVYGEAGYVLEDVPHLTDYMPDLPTYPNPLQDNPAYSVVKQYFVNRDDTVAQKIVV
HKTSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTKI
LGIEGGYRGFYARNTISLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYI
IGGDGTQKGASMIFEEIQRRGLKVVVAGIPKTIDNDIAVIDKSFGFDSAVEEAQRAINAA
HVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEYIEKR
LKENGHMVLVVAEGAGQELMAENMRSMGHEDASGNKLLLDVGLWLSQKIKDHFASRKKKM
AINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHR
ITEAQNKVVITDRMWARLLSSTNQPSFLSHKDVEDARKEEAPPTQLLDGENCKDGHHVKD
VVDNGLACNGTR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgtgcctaattccacgccggtccctcagaagcttcacgtcggatccaacggg
attatacccaattcgaaccacttccttgatctgaggagttctctttcttccgtcgaggcc
ccgggccggaacggcgatccgaagctccaatctgggaggaagatggggttggagattaaa
accaatccgaaaatcgtttatggagaggccgggtatgttcttgaagatgttccgcacctc
accgattatatgccggatctccctacctatcccaatccgctgcaagataatccagcatac
tcagttgtgaagcagtattttgtgaatcgggatgacactgttgcccagaagattgtggtt
cacaagaccagccccagaggaacccattttcgacgtgctgggccccgccaaagggtgtat
ttcgagtcagatgaggtgcatgcatgcatcgtaacatgtggaggcctgtgccctgggctt
aacacagtgataagagaaatagtatgcggcttgtcgcacatgtatggtgtcaccaaaatc
cttggcatagagggtggatacagaggtttctatgcacgcaataccattagtttgacgccc
aagactgttaatgatattcacaaaaggggaggcaccatccttggcacatcacgaggcggc
catgatacgtcaaagatagttgatagcattcaggatcgtgggattaaccaggtctatata
attggaggagatggaactcaaaagggggcctccatgatttttgaggaaattcaaagaaga
ggccttaaagttgttgttgctggcattccaaagacgatagacaatgacattgcggttata
gataagtcgtttggttttgatagtgctgtggaagaggcccaacgggcaatcaatgcagca
catgtggaagctgaaagtgttgagaatggaataggtgttgtgaagttaatgggtcgctat
agtgggtttattgcaatgtatgccactcttgcaagccgagatgtggactgttgcttgatt
ccagaatcacctttctatcttgaagggaagggtggactttttgaatatatagagaagcgt
cttaaagagaatggtcacatggttcttgttgttgctgagggtgcaggacaagagcttatg
gctgaaaatatgcggtccatgggccatgaagatgcttctggaaataagctactccttgat
gttggcctttggttgtctcagaaaataaaggatcactttgcaagcagaaagaagaagatg
gcaataaatcttaaatatatagatccaacatacatgattcgtgcaattccaagcaatgcc
tctgacaatgtttactgcacattgttggcacatagtgccatccacggtgccatggcagga
tacactggttttactgttggtcctgttaatggccgacatgcttacataccgttccatagg
attacagaagcacagaacaaggttgtgataactgataggatgtgggcaaggctactctct
tcaactaatcaaccaagttttctgagccataaagatgtggaggatgcacgaaaggaagaa
gcaccaccaacgcaattgttggatggggagaactgcaaggatggtcatcatgttaaggat
gtagttgacaacggtctggcgtgtaatggcactaggtga

DBGET integrated database retrieval system