KEGG   Elaeis guineensis (African oil palm): 105051934Help
Entry
105051934         CDS       T03921                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 9, chloroplastic
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00061  Fatty acid biosynthesis
egu00071  Fatty acid degradation
egu01100  Metabolic pathways
egu01212  Fatty acid metabolism
egu04146  Peroxisome
Module
egu_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105051934
   00071 Fatty acid degradation
    105051934
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105051934
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egu01004]
    105051934
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egu04147]
    105051934
Enzymes [BR:egu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     105051934
Lipid biosynthesis proteins [BR:egu01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   105051934
Exosome [BR:egu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   105051934
  Exosomal proteins of breast cancer cells
   105051934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 105051934
NCBI-ProteinID: XP_010930884
LinkDB All DBs
Position
9
AA seq 697 aa AA seqDB search
MNPYIVGIFVPLLFSFVLRKTKDGKKRGVPADVGGEPGYAIRNYRFTSLVETHWQGIRTL
AELFENSCKLFPYKPLFGSRKLISRETERTQDGRSFEKLHLGNYEWMSYGEAFKAVCNFA
SGLVHLGHKKDERVAIFADTRAEWLIALQGCFRQNITVVTIYASLGEEALCHSLNETEVS
TVICGHKELKKLVDIRGQLDNVKRVIYVNDEGISNEVSSAKKNASWTMTSFVEVERLGRE
NPVDAYLPVSADIAVIMYTSGSTGLPKGVMMTHGNLLATVSAVMTIVPALGNKDRYLAYL
PLAHVLELAAEHVMVAAGSSIGYGSPLTLTDTSNKIKKGTKGDASILGPTLLASVPAILD
RVRDGVWKNVDAKGGLSKKLFDIAYNRRLAAINGSWFGAWGVEKILWDILVFRKVRAVLG
GHIRFLLSGGAPLSGDTQRFINICLGAPIGQGYGLTETCAGGTFSEYDDASVGRVGAPLP
CSYIKLIDWPEGGYLITDSPMPRGEIVIGGPNVTPGYFKNEEKTKEVYKVDERGMRWFYT
GDIGRIHPDGCLEIIDRKKDIVKLQHGEYVSLGKVEAVLIVSPYVDNIMLHCDPFHSYSV
ALVVPAQQAVENWAMKQGIAYSGFADLCQKEETVKEVHRSLVEAAKQARLEKFEIPSKIK
LLPEPWTPESGLVTAALKLKRENIRRAFADDLAKLYA
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatattgttggcatctttgtgccccttctgttctcttttgtcttacgtaaa
acaaaggatgggaagaagcggggagtgcctgctgatgttggtggagaacctggatatgca
attcgtaactaccgtttcacttccctagtggaaacacactggcaagggatcagaacactt
gctgagctgtttgagaattcctgcaagctgtttccatacaagcctttgtttggctcccgt
aagcttatttccagggaaacagaacgaactcaggatggtagatcttttgagaagctccat
ttggggaactatgaatggatgagttatggtgaagctttcaaagccgtctgcaattttgca
tccggtctagtgcatctcggccacaaaaaggatgagcgcgtcgctatctttgctgacaca
cgggcagagtggctaattgccttgcagggttgcttcaggcaaaatatcacagtggtcact
atatatgcttccctgggggaggaggctctttgtcactcgttaaatgagacagaggtttca
actgtaatctgtggacataaagaattaaaaaagctggttgatataaggggacaacttgac
aatgtaaaacgtgtgatttatgtgaatgacgagggtatctcgaatgaagtatcatcagct
aagaagaatgctagttggactatgacatcatttgtggaagtagagagactgggtcgggaa
aaccctgttgatgcatatttgcccgtctcagctgacattgcagtgataatgtatacgagt
ggtagcactggtttgcctaagggggtaatgatgacacatggcaatctcctagctactgtt
tcagctgttatgacaattgtccctgcacttggtaataaggacagatatttagcatacctg
cctctagctcatgttcttgagttggcagcagagcatgtaatggttgcagcaggaagttct
ataggatatgggtcacctttgactcttactgatacatcgaacaagataaagaaaggaaca
aagggtgatgcttccatcttgggaccaacactgttggcttctgtacctgctattcttgac
cgtgttcgtgatggtgtgtggaaaaatgtagatgcaaagggtggcttatcaaagaaatta
tttgatatcgcatataatcgtaggttggcagctattaacggaagttggtttggagcatgg
ggtgtagagaaaatcctatgggatattcttgtcttcagaaaggttcgagcggtcttgggt
ggtcatattcgttttctactgtctggaggggctcctctctctggtgatacacaaagattt
atcaatatatgccttggggctccgatagggcaaggatatggtctcactgaaacttgtgct
ggtggaacattttctgaatatgatgacgcatctgttggtcgtgttggtgcgccacttcct
tgttcatatatcaaactgattgattggccagaaggcggatatttaatcacagattcacca
atgcctcgaggggaaatagttattgggggtccaaatgtaactccaggatatttcaaaaat
gaagagaaaacaaaggaggtttacaaggttgatgaaagggggatgagatggttttatact
ggtgatattgggcgtattcaccctgatggttgccttgaaattattgatcggaagaaggac
atagtgaaactccaacatggtgaatatgtttctttaggaaaggtagaagctgttctcatt
gtgagcccttatgttgacaacatcatgctccattgtgatccttttcatagttactctgtc
gcacttgtggtacctgcacagcaagcagtggaaaattgggctatgaagcagggaattgct
tacagtggttttgcagatctatgccaaaaggaggaaactgtcaaagaagtacatcgatca
ttagtagaggcagcaaaacaagcacgtttggagaagtttgaaattccatccaagatcaaa
ttgcttcccgaaccatggacacctgagtctggtcttgtcacggctgcactcaagctgaag
agagagaacattagaagggcatttgctgacgatcttgccaagttgtatgcttga

DBGET integrated database retrieval system