KEGG   Elaeis guineensis (African oil palm): 105051936Help
Entry
105051936         CDS       T03921                                 

Definition
(RefSeq) uncharacterized protein LOC105051936
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00061  Fatty acid biosynthesis
egu00780  Biotin metabolism
egu01100  Metabolic pathways
egu01212  Fatty acid metabolism
Module
egu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105051936
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    105051936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egu01004]
    105051936
Enzymes [BR:egu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     105051936
Lipid biosynthesis proteins [BR:egu01004]
 Fatty acid synthase
  Component type
   105051936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-GeneID: 105051936
NCBI-ProteinID: XP_010930888
LinkDB All DBs
Position
9
AA seq 241 aa AA seqDB search
MEASAMTRSLLSAPPLHSNPFLSCHGSNTDLLAFPSPKSQRRNALPPVLSLANPKSPAWA
LGLERRRSFLTRCSVDSAVKTEEEVPIEKRIPPFPTVMDINQIRDILPHRFPFLLVDRVI
EYQPGVTAVGIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENF
FFAGIDKVRFRKPVIAGDTLVMRMTLIKLQKRFGIAKMDGKAYVGGDLVCEGEFLMATGS
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctccgccatgacgagatcgctcctctccgcgcctccccttcactccaatccg
ttcctctcttgccatggctccaatacggacctcctcgcctttccttcccccaaatctcaa
cgaaggaatgctcttcctcccgttctgtcgctcgcaaaccctaaatctcccgcttgggcg
ctcggattggagaggcggagaagcttcctgactcgctgctccgtcgatagcgcggtgaag
acggaagaagaagtcccgatcgagaagaggattccgccttttccaacggttatggatatc
aaccagatccgtgatattttacctcatcggttcccgtttcttctagtggatagagtgatc
gagtaccagcctggagttactgctgttggtatcaagaatgtcacgatcaatgataacttc
tttcctggtcacttcccggagcgaccaataatgccaggtgttctcatggttgaggccatg
gctcaagttggcggtctcgtaatgctgcaaccggaagtgggtggctctcgtgagaatttc
ttttttgctgggattgacaaagtgaggtttcggaaacctgtgatcgcgggggacaccttg
gtaatgaggatgacactgatcaaactgcaaaaacgctttgggatagcgaagatggatggg
aaagcatatgttggtggtgatttggtatgcgagggtgaatttttgatggccactggaagc
gaatga

DBGET integrated database retrieval system