KEGG   Elaeis guineensis (African oil palm): 105052538Help
Entry
105052538         CDS       T03921                                 

Definition
(RefSeq) glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00071  Fatty acid degradation
egu00592  alpha-Linolenic acid metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01212  Fatty acid metabolism
Module
egu_M00087  beta-Oxidation
egu_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105052538
   00592 alpha-Linolenic acid metabolism
    105052538
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     105052538
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     105052538
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     105052538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 105052538
NCBI-ProteinID: XP_010931678
LinkDB All DBs
Position
10
AA seq 722 aa AA seqDB search
MAKGRTEMEVGPDGVAVITIINPPVNSLSVDVLFSLKDSYEQALNRDDVKAIVITGAGGK
FSGGFDITAFGGLQGGQRDQPKVGYVSIDIITDTLEGARKPSVAAIDGLALGGGLEVAMA
CHGRVSTSTAQLGLPELQLGIIPGFGGTQRLPRLVGLTKSLEMILMSKPIKGEEAHAFGL
VDAIVSPEELVKTARCWALDIAEFRRPWIRSLYRTDKLEPLGEAREILKFARSQTQKRAP
NLQHPLVCLDVVEEGIVSGPRAGLWKEANAFQTLLFSDTCKSLVHVFFAQRATSKVPGVT
DLGLVPRKITKVAILGGGLMGSGIATALILSNYPVMLKEVNEKFLKAGIDRVKANLQSRV
KKGKMSQEKFERTLSLLTGVLDYESFKDVDMVIEAVIENVSLKQQIFADLEKFCSPHCIL
ATNTSTIDLNLIGEKTMSQDRIVGAHFFSPAHIMPLLEIVRTHKTSPQVVTDLLDVGKKI
RKTPIVVGNCTGFAVNRMFFPYTQSALFLVDRGVDVYKIDRACTKFGMPMGPFRLADLVG
FGVAVATGMQYLENFPERVYKSLLMSIMLEDKRSGEATRKGFYKYDEKRKASPDPEIKKY
IEKSRSMAGITPDLELMKLADKDIVEMVFLPVVNEACRVLDEGIVVKASDLDIASIMGMG
FPPYRGGIMFWADSLGANYVHSKLNAWSNKYGQLFKPCTYLAERASKGLSLSAQVNQARA
RM
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggggagaacagagatggaggtcgggccggacggggtcgccgtcatcaccatc
attaaccctcccgtcaattcgctctcggtcgacgtattattcagcttaaaagatagttat
gagcaagctctaaacagagatgatgtgaaagctattgttattacaggagctggagggaaa
ttttctgggggttttgacatcactgcctttggtggtcttcaaggcggacagagggatcaa
ccaaaagttggctatgtttcaatagatatcatcactgacaccttagaaggtgcaagaaag
ccatcggtggctgctatagatggcttagcacttggtggtggactggaggttgcaatggca
tgccatgggcgcgtttctacttctactgctcaactaggtctgccggaacttcaacttgga
attattcctggatttggaggaacacaacgacttccacgccttgttggacttacaaaatct
cttgaaatgattctgatgtcaaagccaataaaaggagaggaagctcatgcatttggtcta
gttgatgccatagtttcacctgaggagttggtgaagactgctcgctgttgggctctggat
attgctgaattcagaagaccatggatcaggagcctttacagaactgataagttagagcct
cttggagaggctagggagatactaaagtttgcaagatctcaaactcaaaaacgagctccc
aatctgcagcacccattggtatgtcttgatgtagttgaagagggtatagtttcaggacct
cgtgctggactttggaaggaagcaaatgctttccagacacttcttttctctgacacatgc
aagagcttggttcatgtcttttttgcacaacgtgcaacctcaaaggtgcctggtgtcact
gacttgggtttggttcccagaaaaataactaaagttgctattcttggaggaggtctgatg
ggttctggaattgcaactgcactaatcctgagcaattatcctgtgatgttaaaagaagtc
aatgagaagttcttaaaagcagggattgacagagtcaaagccaatttgcagagtcgtgtc
aagaaaggaaaaatgtctcaagagaagtttgagagaaccctttcgcttcttacaggtgtt
cttgattatgaatccttcaaagatgtggatatggtcattgaggcggtcattgagaatgtg
tcactgaagcagcaaatatttgctgatctggagaaattttgctcgccccattgcatactt
gctaccaacacttcaacaatagatctcaatttaataggagaaaaaaccatgtctcaggat
cgtattgttggtgcacatttctttagtcctgctcatatcatgccactcctagaaatagtt
cggactcataaaacatcaccgcaagttgttacagacttactagatgttgggaagaagatt
cgcaaaactccaatagtagttgggaattgtactggctttgctgtcaacaggatgttcttt
ccttacactcagtcagcgctttttttagttgatcgtggtgttgatgtctataagattgac
cgtgcatgtacgaaatttggaatgccaatgggccctttcaggcttgccgatctggttggt
tttggggttgcagtagctactggcatgcaatacctggagaacttccctgaaagagtctat
aaatcattgttaatgtcaataatgcttgaggataagagatcaggtgaagctactcgaaag
ggattctataaatatgatgagaagcggaaggccagtcctgaccctgaaataaagaagtac
atcgagaaatctaggagcatggctggcattacacctgatcttgagctaatgaagttagca
gataaggatatagtagaaatggtattccttcctgttgtaaatgaggcctgccgagtcctt
gatgagggaattgttgtgaaggcatcagatcttgatattgcttccatcatgggcatgggc
ttccccccttacaggggtggcataatgttttgggcagactctcttggtgcaaattacgtc
cactcaaaattgaatgcatggtcaaataagtatggtcaacttttcaagccctgtacatat
ctggcagaaagagcttctaaaggcctatctctgagtgcccaagtgaatcaggcaagggct
cgaatgtag

DBGET integrated database retrieval system