KEGG   Elaeis guineensis (African oil palm): 105052811Help
Entry
105052811         CDS       T03921                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZ1-like isoform X1
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    105052811
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egu03036]
    105052811
Enzymes [BR:egu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105052811
Chromosome and associated proteins [BR:egu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105052811
   Polycomb group proteins
    PRC2-EZH2 complex
     105052811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 105052811
NCBI-ProteinID: XP_010932044
LinkDB All DBs
Position
10
AA seq 926 aa AA seqDB search
MASKASSSASASRSMPPASLQIIGIKEGNHTSLDVLSVIDSLMKQVVADRYIYIKERMEE
NKQKLSSIMQHIGNLSKFRRDTTSNNANIDVNLLTKRQDDALCMLSSLELSGGEKDSSSC
QEESSYASSIVLIGTNYGGKSTVRPIKLPEVLKLPPYTTWIFLDRNQRMAEDQSVVGRRR
IYYDQSCGEALICSDSEEDVVEDEEEKREFRSTDDYIIRMTIQKVGLSDAVLDSLAQCLE
RNTDEIRARYDSIIKIEKTEESDKKGQGGVDIQIEDALSEKDLDAALDSFDNLFCRRCLV
FDCRLHGCSQDLVFPSEKQLAWSNSDDVTPCGSHCYRLVPKSESMATVNSEVLRVFEEPT
QSSGSARASLSPKKKSQGSSGGRKGKSHQSESASSNARVVSESSESEVHPRQDTMSVQLS
SPLKIKQGGKSGIRKKDNKRIAERVLVCMRKKQKKMMPPDSDSIVSGCLWPHDMKLRSNS
RNGSKDSTSSSLNKVVKSPIIRSSRKKGLSHQDNINSACIETQNDSTGEIVKESLATDCD
ESSRKEEFVDENICKYENTYGKSWKVIEQSLFVKGLEIFGRNSCLIARNLLSGMKTCMEV
FQYMNYVEDKRTYGAADGANSLVQGHGKVDYTESMARSRFLRRRGRVRRLKYTWKSAGYH
SIRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAK
SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVL
LGRSDVSGWGAFLKNSVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVL
DAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPA
WARKPEASGSKKDETQPSTGRAKKLA
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaagcctcgtcatcggcttccgccagcagatccatgccccccgccagcctt
cagataattggaattaaagaaggaaatcatacttctctggatgtcttgtcagttattgat
tccttgatgaaacaagttgttgctgatcgttacatatatattaaggaaagaatggaagag
aacaagcagaagctaagtagcatcatgcaacatattggtaatttgtcgaagtttaggaga
gatacgacatcaaacaatgctaacatagatgtaaatttgttaacgaaaaggcaagacgat
gcactttgtatgctaagtagtcttgaactatctggaggggaaaaagatagcagtagttgt
caagaagaaagttcatatgcctcgtcaattgtacttatagggaccaattatggaggaaag
agtacagttcgtccaatcaaattgccagaagtgctaaaattacctccatatactacatgg
attttcttggacagaaatcaaagaatggcagaggaccagtctgttgttggtcgtaggaga
atttattatgatcaaagttgtggtgaagctttgatttgcagcgacagtgaggaggatgta
gttgaagatgaagaagagaagagagagtttcgaagtactgatgattatattattcggatg
accatccaaaaagttggtttatcagatgctgtgctggattcattggctcagtgccttgaa
aggaatactgatgaaatcagggcaagatatgatagcattataaagatagagaaaactgag
gagtctgataaaaagggacaaggtggagttgatattcaaattgaagatgcattatcagaa
aaagatctggatgcagcattggactcttttgataaccttttttgtaggcgatgtctggtt
tttgactgtagactgcatggatgctctcaagatttggtatttccttcagaaaaacaactt
gcctggagcaactcagatgatgtcacaccttgtggcagtcactgctacagactggtccca
aaatcagagagtatggctacagtgaattctgaggtgctacgtgtttttgaagagccaaca
cagtcatctggtagcgctcgagcatcactgtctccaaaaaagaaaagtcaaggttcttct
ggaggaaggaaagggaaatctcatcaaagtgaaagtgcttcttccaatgcaagagttgtt
tctgaaagtagcgaatctgaagtgcacccacgacaggataccatgtctgttcaactctct
tcgcccttgaaaattaaacagggtggaaaatctggtattcggaagaaagacaacaaaaga
attgctgagcgggttcttgtatgcatgcggaaaaagcagaagaaaatgatgcctccagac
tctgattccattgttagcggatgcctctggccgcatgatatgaagcttagatcaaattca
cgtaatggcagtaaagattctacttcatcttcactgaacaaagttgtcaaatctccaata
atcagaagttccagaaaaaaaggactatcacatcaggacaatatcaattcagcttgcatt
gaaactcaaaatgattctacgggtgagatagtgaaagagtcactggccacagattgtgat
gaaagttcaagaaaagaggaatttgtcgatgagaacatttgcaaatatgaaaatacttat
ggtaaatcttggaaagtgattgagcaaagcctttttgttaaaggtctggaaatttttgga
aggaacagttgcctgattgctagaaatcttttaagtggaatgaaaacatgtatggaggtt
tttcaatacatgaattatgtggaagataaaagaacatatggagctgctgatggtgcaaat
tctctggttcaaggccatggcaaggttgactacactgaatctatggcaagatcaagattc
ttgagaagacgaggtagagttcgtcgcttgaaatacacttggaaatccgctggttaccat
tccataagaaaaagaattacagagagaaaggatcagccttatcggcagtataatccttgt
ggctgtcaatctgcttgtggaaagcaatgcccttgcctcgtaaatggcacgtgctgtgaa
aaatattgtgggtgtcctaaaatttgtaagaaccgatttcgaggttgtcattgtgccaag
agccagtgtcgaagccgtcaatgcccatgctttgctgctgatagggaatgcgaccctgat
gtttgtagaaattgctgggttgggtgtggcgatggtactttaggaggtccaaatcaaaga
ggagataattatgaatgccggaatatgaagcttctcctcaaacaacaacaaagggtctta
cttggaagatctgatgtttctggctggggagcattccttaagaatagtgttggtaaacat
gaatacctcggggaatacactggagaattaatctctcatcgagaagcagataagcgtgga
aagatatatgaccgtgaaaattcatcatttcttttcaacctgaatgatcagtttgttctc
gatgcataccggaagggagataagttgaagttcgccaaccattcccctgatccaaactgc
tatgccaaggtcatcatggtagcaggtgatcatagggtaggtatatttgccaaagaaagg
ataagtgcaggggaggaactcttttatgactatcgttacgagccagaccgtgcacctgct
tgggctcgaaaaccagaagcttcaggctcgaagaaggatgaaacgcagccttctactggt
cgagccaaaaagcttgcataa

DBGET integrated database retrieval system