KEGG   Elaeis guineensis (African oil palm): 105056273Help
Entry
105056273         CDS       T03921                                 

Definition
(RefSeq) serine/threonine-protein kinase ATM isoform X1
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    105056273
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egu01001]
    105056273
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egu03032]
    105056273
   03400 DNA repair and recombination proteins [BR:egu03400]
    105056273
Enzymes [BR:egu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105056273
Protein kinases [BR:egu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   105056273
DNA replication proteins [BR:egu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     105056273
DNA repair and recombination proteins [BR:egu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    105056273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FATC TAN
Motif
Other DBs
NCBI-GeneID: 105056273
NCBI-ProteinID: XP_010936715
LinkDB All DBs
Position
13
AA seq 3016 aa AA seqDB search
MATTKDVQEIISKLSSQKAKARDEGIKLLNSWLEGERSISFCRLLGQNTVRIKPNEIPHA
ETWPFLITLLTKCIALEISASKKRPPKLILAKTLRTAIQCAEDQKLSGQKLLLFSVVKLL
FNHIWDVIKDASSFQSEYSSILRHLLTVKDYRYQMRKPVYCSLVGLYINKVELSIDMKSN
SHSSSKEEAFRYILSLHALLENPPGDFPDDIREDLVKGFIRIFSQIRDEGKFSRKLMECI
NTYLLKDGPNLGYQAMEIHSAVQQFMFRHWLTTHDRGLKNSFVLYARVQLKLSRTMSERS
PLMEQLLDVIIKELDQSTNTGTGFLWSDMSRDDKVGTLGGTQQGLMELAATVFYQACKKT
TKTSYQEKRLKMEHPASRIKDGIMKGLWLWNGAFSFLIHNYGIRVDKSLLIYWFEAMRES
LRRILDSSSALHSYDSLLWLLRALQELFYVLPLCPLKKPSHCSSFTSNETLLLRVGWQDV
WSCLLHGLPIFSNVTPIVDVALTLLSNMVLQDRISVAVVPQDIWDLRIFKNMPSSSALYF
IACYFSRSGVQGELRDALYLRKSLLRSVLESINFKEPTFFTEQTVLLIMEAIFSLSIGSS
TLLPYAGAIFVSSEPNEESKKPSLTEEGDHGIVDEVLDCSVESLAELEAENSSEVKTEHH
HSIRLPRQIRQPLIHEMEEYITGFVTSNVEFDKKPLSDLIYSCSLLCNCIYASALKRQRG
EKSLFFNKIFDYISKVLDHTVWMIEDKCNEIQHHGYANICSILGAYGSTLSSFHSLNSSP
LFTFWKDNSNIDCEPLVGIIKSIEKLLVVLAELFALLSNITSNPEIQIDLPTITGSSSPQ
ESTSMVRIVDIDLDANNACKDVDALTASGSRSSVISSSPFQWKLELVKVISTFFSISPLH
TWEVLFELMEKENDAKVHEEIQYILCKKFSGPAGNLSSLVGSIDTTMRNCASLKLCCHDI
LPAICALLGSLLTVGSNQKNGNPKQCKGEMLSEEILNALCDMVNTVAEIGLPDWFVRVQL
IDCICCFVLLEPHSAQVMIEKLLAMLQDTDYRVRLFLARKVGVLFLTWDGHNELFHDICL
NFGFEMVMASKGKLVKAAEVSASGAQPVLAMETALITLAHLALCSEEVEAEAVFMICVVA
ATEPGQRELAFALFDTLSRKLQYASRSKYLEQLMGSILARWVACEVSLMALVEVQDLFLC
KSDVRCFVQYCCPWLLAPLILREDITNLNWVSKVSCQPLPDIVKEYFVPIFAVCMAVHCS
GKPDKELGRMALCKSVLHLAKISELERDDLIKKHMVSIVSCLLSLTCSFTVPDMPLFTKE
TVVLSVQTVVDGFLETDQRPTNIGIIDKINIFRPDRVFKFLVEIHYQIAAAVHPRHKCHR
LSSIEVLIHIIGHRAAVSSTSCYIFNIVGQDIGNQPLQKQCCAILSTLLEAFKVDPSKEV
VSVLGEQLQFLVSKLVACCIPAENKREPSCVHSSGLLSLLNQLTVDADLSLYDYIRELEP
FPDLDCLERIRVFHDGLCNVYSPRDQFLKFVRRACYLPQGLLMCSLRHLHKKLVLGEIIQ
KETNVPDESGKSNCRNCDPDVVSAVWTLVGLCGSNEANNMSVLVADFISRIGIGDPYRVV
FHLPKDSCRNLSFKSSSWESSFCTSIVVSDGLLIDLLRLLKKYLLDDHVKIVDMTSRTLR
GILSTEKGQGVLLSLDSYESSLIAVHSKGVNLDLVDKLLLDSENYSGEAISLEDPSLWQT
EGKTYEQWICSLVHSLISHCDDIILRLCQNIVLLKAEIAELLLANVLLSIAGKVDLSSDL
CQLISAKVQENIFDESNGLVKSIQVFLDALNELRSCFVAEKANSFSTPVKHGRPSSFGRT
RNTFEKSKDCPSNILTLHSSWKKVYWLALDYLVVAKAAIHCGSYFTAVMYAEYWCEEHFN
CLALGSPDFSHLELLPSHIELLVAAFTQINEPDSIYGILQSNKLTSQIITFEHEGNWNKA
LEYYDLLVRSSEMGRIDCLSGKPSVDDSCNSSLGDGNMGDWKYYKGLMRSLQKTGCTHVL
DVYCQGLTNRRGCFQHDSEFTDLQYEAAWRAGNWDFSLITPNSKTHSTPYMSGQFNENLH
SCLRALQEGSGDEFHMKLRDSKKELVLSMSNASMESTEYIHSTIVKLQILDHLGMAWDLR
WKPCCPERKGSFFELNNIIPGPVVPTRVQLEWLNADWNFILKQAQLHLNLLEPFIAFRRV
LLQILDCRDCTAEHLLQSAFTLRKGSRFSLAAAALHELKLLCRQTEEQTTSHAYFLGRVE
EAKLLRAQGQHEMAINLARYILQNYSQGEEISNVYRLVGKWLAETRSSNSRTILEQYLKQ
SVELTKASKSTDKKSISRQCQTYFDLAHYTDGLFKSYEERLSSSEWQAAMRLRKHKTREL
DALIRRLKSSSKGEKTDYSVKIQELQKQLTMDREEAEKLQDDRDNFLSLALEGYQHCLVI
GSKYDLRAVFRLVSLWFSLYSRQNVVKSMNSTVKEVQSYKFVPLVYQIASRLGSSKDGQG
STSFQIALASLVRKMAIDHPYHTMFQLLALANGDRVKDKQRSRNSFVVDLDKKLAAEKLL
NELSSYHGALIQQMKQLVEIYIKLAELETRKEETNKRIPVPREIRSLRRLELVPVVTATV
PIDPSCQYGQGSFPHFKGLSDSIMVMNGINAPKVVDCFGSDGHKYRQLAKSGNDDLRQDA
VMEQFFGLVNTFLQNQRDTWKRRLRIRTYKVVPFTPSAGVVEWVDRTVPLGEYLLGSTRN
GGAHGRYGIGDWSFLRCREHMTGEKDKRKAFLKVCDNFRPVMHYFFLERFMQPADWFVRR
LSYTRSVAASSMVGYIVGLGDRHSMNILIDEDTTEVVHIDLGVAFEQGLMLKTPERVPFR
LTREIVDGMGVTGVEGVFRRCCEETLSVMRTNKEALLTIIEVFIHDPLYKWALSPLKALQ
RQKEIDDDVDSCLESSQDAYEGNKDAARATLRVKEKLDGYEGGEMRSVQGQVQQLIQDAT
DTDRLCQMFPGWGAWL
NT seq 9051 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacgaaagacgtccaagagatcatctctaagctctcctcccagaaggccaag
gcccgcgacgaagggatcaagctgttgaatagctggctggagggcgagagatcgatcagt
ttctgtaggctactcggtcagaacaccgtcaggatcaagcccaacgagatccctcatgct
gagacatggccttttcttatcacattgctgacgaaatgtattgcattggagatctctgcg
agcaagaaacgtccaccgaaactaatactggcaaagactcttcgcactgccatccaatgt
gctgaggatcagaagctatcagggcaaaaactcctcctgttttctgttgttaagcttcta
tttaatcacatttgggatgttataaaagatgcttctagctttcagtcagaatacagcagc
atcctacggcatcttctaactgttaaagattaccgctatcaaatgaggaagccagtttat
tgcagtctagtgggtctatacataaataaggtagaactgtccatcgacatgaaatctaat
agtcattccagctccaaagaggaagccttccgctatatcttgtctcttcacgccctactg
gaaaatccacctggtgattttccggatgacatcagggaggatcttgttaaggggtttatt
agaattttttcacagattagggatgaggggaagttctcacgcaagctaatggaatgcatc
aatacctacttgctaaaagatggcccaaatcttggatatcaagccatggaaattcattct
gctgtacaacagtttatgtttcgtcattggcttactactcatgatcgaggattaaagaac
tcattcgttctctatgcaagagtacaactaaagctcagcaggactatgtcagaacgaagt
ccacttatggaacaacttcttgatgttattatcaaggaattagaccaaagcactaatact
ggtactggtttcctgtggagtgatatgtctagagatgataaggttggaactcttggaggc
actcaacaaggcttgatggagcttgctgctacagttttttatcaggcttgtaaaaagaca
acaaagacatcatatcaggagaagcggctgaaaatggagcatcctgcttctcgcattaag
gatggaatcatgaaaggcttatggctttggaatggtgccttttcttttcttattcataac
tatgggattcgtgtagacaagtctctcttaatttattggtttgaagccatgcgtgaaagt
ttaagaaggattttggatagctcaagcgctttgcattcgtacgattctcttctttggctt
ttgcgggctttacaagaattgttttatgtgcttccactttgccctctgaagaagccttca
cattgttcatctttcacttcaaatgagactttgctacttagagttggttggcaagacgta
tggagctgtttgctgcatggactacccatattcagcaatgtcacaccaattgtagatgtt
gctttgacactactcagcaatatggttttgcaagatcgaatcagtgtagctgttgttcct
caagatatatgggatttgcggatttttaagaatatgccatcatcgtctgccttgtatttc
attgcttgctacttctcaagatcaggtgttcagggtgaactacgagatgccttatatctt
agaaaaagtctactaagatcagtcttggaatcaattaactttaaggaacctacgtttttc
accgagcaaactgttttgctcattatggaagctattttttctctttccattggttcctct
actcttctgccttatgctggagctatatttgtttcttcagagcccaatgaggagtcaaag
aagccttcgttgaccgaagagggtgaccacgggattgtagatgaagttttagattgttcc
gtggaatccttagcagaacttgaggcagaaaattccagtgaggtgaaaactgagcatcat
catagcatacgccttcctaggcagattagacaaccattgattcatgaaatggaggaatat
atcactggttttgtaacatcaaatgtggagtttgataaaaaacctttgtcagatcttatc
tattcatgctcacttttatgcaactgcatctatgcttcagcattaaaaaggcaaagaggt
gaaaagtctttgttcttcaataagatatttgactatatttcaaaggttctggatcataca
gtttggatgatcgaggataagtgtaatgaaattcagcatcatggttatgcgaatatatgc
tccattcttggtgcatatggatccactttatcttctttccatagcttaaattcatctcca
ctttttacattttggaaggataatagcaatattgattgtgagcctcttgtaggaatcatt
aaatcaattgagaaacttttggtggttcttgctgaactgtttgctttgctttccaatatt
acaagtaatcctgagatacaaattgatctgccaacaataactggatctagttctccacaa
gagtccacttctatggtgcgaattgttgatattgatttagatgccaataatgcttgcaag
gatgttgatgctttgactgctagtgggagtagaagttcagttatttcttcctctcctttc
caatggaagctagaactagtcaaagtgatttcaacttttttctctatatcacctcttcat
acatgggaagtcttgtttgaactaatggaaaaagaaaatgatgctaaggtgcatgaagaa
attcaatatattctttgcaaaaaattttctggccctgctggaaatctgtcctcattggtt
ggttctatagataccacgatgagaaattgtgcaagtttgaaactttgctgtcatgatatt
ttacctgccatctgtgctttactgggatccttactgacagtgggttctaaccaaaaaaat
ggcaatcctaagcaatgcaagggggaaatgctctcagaagagatcttaaatgccctctgt
gacatggtaaacactgttgcggagattggtcttcctgattggtttgttcgtgttcagcta
attgactgtatttgttgttttgttttactagaaccccactctgcccaggtcatgattgaa
aagcttcttgcaatgcttcaggatactgattatcgagttagactttttttggcaagaaaa
gttggtgttcttttcctaacatgggatggccataatgagttgttccatgatatttgtttg
aacttcggtttcgagatggtgatggcctcaaaagggaagcttgttaaggctgcagaggtc
tcagcttctggtgctcagcctgtcctagctatggaaactgctcttatcacccttgcacat
cttgccttgtgtagtgaggaggttgaagctgaggcagtcttcatgatatgtgtggttgca
gctaccgagcctggtcaaagggaattggcatttgctttatttgatactttgtcaagaaaa
ctccaatatgcatccaggagtaagtatttagagcaactcatgggatcgattcttgctcgt
tgggtagcttgtgaagtaagcttaatggcactagtggaggtacaagatctctttctttgt
aaatcagatgttagatgctttgtgcaatattgctgtccttggctccttgcacctttaatt
ctacgagaagatatcacgaatcttaattgggtatccaaggtttcttgtcagcctctgccc
gatattgtgaaggaatattttgtgccaatttttgcagtatgcatggcagtgcattgcagt
ggaaaaccagacaaggagttgggaagaatggcactttgtaaatcagttttgcatcttgcc
aaaatttctgagctggagcgagatgaccttataaagaaacatatggtgtcaattgtcagc
tgccttttgtcactcacttgttctttcactgtcccagacatgcctctttttaccaaggag
actgtggtcctttcagtgcaaactgttgttgatggttttttggaaacggatcaacgtcct
acaaatattggtatcattgataaaattaacattttccgccctgatagggtttttaagttt
ttagtggagatacattaccagattgcagctgctgttcatccacggcataagtgccatcgc
ctctcttcaattgaggttcttatccatataattgggcatagagctgctgtttctagcact
tcatgctatattttcaatatagtgggacaggatattgggaatcaacctttacaaaagcag
tgttgtgctatactatctacattgcttgaagcatttaaagttgacccttccaaagaggtt
gtcagtgtgctaggtgaacaacttcagtttttggtttcaaaattggttgcttgttgcatt
cctgctgaaaacaagagagaaccaagttgtgttcattcatcaggactcttatctttgctt
aatcagcttaccgtggatgctgacttatcactttatgattatataagggagctggaacca
ttccctgaccttgattgtttggagagaatccgggtgtttcatgatggcctgtgcaatgtc
tactctccaagggatcaattcctaaagtttgtcaggagagcttgttaccttccacaagga
ttactcatgtgcagtcttcggcatctgcacaagaagttagtccttggagaaatcatccag
aaagagacaaatgttccagatgaatcaggaaaaagtaactgccggaattgtgatcctgat
gttgtttctgctgtctggactcttgttggtttgtgtggctccaatgaagcaaataatatg
agtgttctggtggctgatttcatatccaggattggaattggggacccttatcgggttgtc
tttcatctaccaaaggattcttgtcgaaacctttctttcaagtcatcaagctgggaatct
agtttctgtaccagtattgtagtttcagatgggctattgattgatcttctcagacttttg
aagaagtacctattagatgatcatgtgaagatagtggacatgacttcacggacactgcgg
gggattctttcgactgaaaagggtcaaggcgtgctgctgtccctcgattcttatgagagc
tctctaatcgcagttcactcgaagggtgttaacttggaccttgtggacaagttactctta
gattctgaaaattattctggtgaagccatttctttggaggatccttccctatggcagacc
gagggtaaaacatacgagcagtggatctgctcacttgtgcactcacttattagtcattgt
gatgatattatcctgagattgtgtcaaaatatagttttgttgaaagctgagatagctgaa
cttttgcttgcaaatgtcctgctgagcatagcaggaaaggttgatttaagttctgatctt
tgccagttaatctcagcaaaggttcaagagaacatatttgatgagtctaatggcttggtt
aagtcaattcaggtgtttttggatgcattgaatgaacttcgatcatgttttgttgctgag
aaagcaaactccttttcaactcctgtgaagcatggcagaccttctagttttggacgaact
cgtaacactttcgaaaaatcaaaagattgtccatctaacattctaacactgcattcttca
tggaaaaaggtttactggcttgcgctcgattatcttgtggttgctaaagcagcaattcat
tgtggatcatacttcacagcagtaatgtatgcggaatattggtgtgaggaacattttaat
tgtctagccctaggaagtcctgacttttcccatctggaattgttgccctcacatatcgag
ctactggttgcagcattcactcagattaatgagccagacagcatatatggaatacttcaa
tcaaataagttgacatctcaaataattacatttgagcatgagggaaattggaacaaagct
ctggaatattatgacctgcttgtaagatcgtctgaaatgggacgcattgattgcttatca
ggaaagccatctgtagatgactcatgtaactcttctctaggagatggaaatatgggtgac
tggaaatattataaaggtctaatgagatctttgcagaaaactggctgcactcatgtgctc
gatgtgtattgccaaggattgaccaatcgaagaggctgttttcaacatgactctgagttt
actgatctacagtacgaggctgcttggagagctggaaactgggacttctcattaattacc
cccaattcgaaaactcattctacaccatatatgagtggtcaattcaatgaaaatttgcac
agttgtttgagagcattgcaagagggcagtggtgatgagttccatatgaaacttagagac
tcgaagaaggagcttgtgttgtctatgtcgaatgcaagcatggagagtaccgaatatatc
cattctactattgttaaacttcagatattagatcatcttggaatggcttgggatttacgt
tggaagccatgttgtcctgaaagaaaaggatcctttttcgaactaaacaacataattcct
ggacctgttgttcctactagagttcagttggagtggctgaatgcagattggaacttcatt
ttaaagcaagcacagctacatctaaatttattagaacctttcattgcttttaggcgtgtt
ctgctgcaaattttagattgcagagattgtacagcagaacatctgctgcaatctgctttc
acgctccgcaagggttccagattctctctagctgctgctgctttgcatgagctcaagtta
ctctgtcgtcaaacagaagaacagacaacatcacatgcttatttccttggaagggtcgaa
gaagctaagcttctcagggctcaaggtcagcatgaaatggctattaatcttgcaagatat
attttgcagaactattcacagggagaagagatctcaaatgtgtatcggttggttggaaag
tggttggctgaaactcgatctagcaattcaagaactattttagaacagtacctgaagcag
tcagtggaacttaccaaggcaagcaagagtacagataagaaaagtatttctagacaatgc
caaacatactttgatctagcacactacacagatggcctatttaaaagttatgaagaaaga
ttgtcctctagtgaatggcaagcagctatgcggttgaggaaacacaagaccagggagttg
gatgcacttattagaagactaaaaagttcttcaaagggagagaagacagactactcggtg
aaaatacaggagttgcaaaagcaactcacaatggatagggaagaggctgaaaaattacag
gatgacagggacaacttcctcagcctagcattggagggttatcagcattgtcttgtcata
ggcagcaaatatgatctgagagcggtatttcgactggtttctttatggttcagcctttat
tcaaggcaaaatgttgtgaaatccatgaatagcactgtgaaagaggtccagtcatacaag
tttgtgccactggtttatcaaattgcttcaagacttggtagttcaaaagatggacaagga
tcaaccagttttcagattgcattggcttcccttgtgcggaagatggccattgatcatcca
tatcataccatgtttcagttactggctttagcaaatggcgatcgtgtcaaagacaagcaa
agaagtcgaaattcatttgttgtagatttggacaaaaaacttgcagcagagaaactcttg
aatgagttgtcttcatatcatggagctttaattcaacagatgaaacaattggttgagata
tatattaagctcgctgaactagagacaagaaaggaggaaactaataaaagaatacctgtg
ccaagagaaatccgtagccttcggcggcttgaacttgtaccagttgtgacagctactgtt
ccaattgaccctagttgccaatacgggcaaggttctttcccacattttaagggattatct
gattctatcatggtaatgaatggcataaatgcacctaaggtggtggattgctttggttca
gatggtcataagtatcgtcaacttgccaaatctggaaatgatgacttgcgacaagatgct
gttatggaacaattctttggtttagtgaataccttcctacaaaatcagcgagatacatgg
aaaaggaggttaaggatacgtacatacaaggtggttccatttactcccagtgctggtgta
gttgaatgggttgatcgtactgttccgcttggtgaatatcttttaggaagcacaaggaat
ggaggggcgcatggacgctatgggataggagactggtcatttcttcgatgcagggagcat
atgactggtgagaaagacaagcggaaagcatttctcaaagtctgtgacaacttcaggccg
gtgatgcactacttctttttggagagatttatgcagcctgctgactggtttgtaagaaga
ctctcgtatacaagaagtgttgcagctagttcaatggtaggttacattgtagggctagga
gatcggcattcaatgaatattctcattgatgaagatacaacggaggtggtacacattgat
cttggtgttgcctttgaacagggtctcatgcttaaaacgcctgagagggttccatttcgt
ctgacgagagagatagtagatggcatgggggttactggggtggagggtgttttcagaagg
tgttgtgaggaaactctctctgtcatgaggacaaataaggaagcgctgcttactatcatt
gaagtttttattcatgatccactctataaatgggctctttcacctcttaaagctttgcaa
cgacagaaggaaattgatgatgatgtagactcatgcttagagagctcacaagatgcttac
gaaggaaacaaggatgcagcacgtgccacattacgtgttaaagaaaagttagatggttat
gaaggtggtgaaatgaggagtgtacaaggccaggtccaacagctcatacaggatgcaaca
gatacggatcgcttgtgccagatgtttccaggttggggagcatggttgtga

DBGET integrated database retrieval system