KEGG   Elaeis guineensis (African oil palm): 105056494Help
Entry
105056494         CDS       T03921                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00250  Alanine, aspartate and glutamate metabolism
egu00410  beta-Alanine metabolism
egu00430  Taurine and hypotaurine metabolism
egu00650  Butanoate metabolism
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    105056494
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105056494
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105056494
   00430 Taurine and hypotaurine metabolism
    105056494
Enzymes [BR:egu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105056494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 105056494
NCBI-ProteinID: XP_010937014
LinkDB All DBs
Position
13
AA seq 495 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTALPRFRMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGESEVAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPEKAVDLVDENTICVAAILGSTLNGEFEDVKLLNDLLEKKNKQTGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNIMENCQENAMVLKRGLES
TGKFNIISKDNGVPLVAFSLKDRSRHDEFEVSDFLRRFGWIVPAYTLPPDAQHITVLRVV
IREDFSRTLAERLVLDIEKVLHELDALPSKVLMPPVIDGVKENGTVIKKGALEVQRSVTE
AWKKFVMAKKTNGVC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctccaagaccgcgtcagagtcggacgtctcggtccactccaccttcgcctct
cgctacgtccgaaccgcccttccaaggtttcggatgccggagaactcgatacccaaggag
gccgcgtatcagatcatcaacgatgagctgatgctggacggaaacccccggctcaacctc
gcatcgttcgtgaccacatggatggagccggagtgcgataagctcatcatggctgccatc
aacaagaattacgtcgatatggacgaatatcccgtcaccaccgagctccagaaccggtgt
gtgaatatgattgcccacctcttcaatgctcctcttggggagtcggaggtggcggtagga
gtcggaactgtgggctcctccgaagccataatgctcgctggattagccttcaagaggaaa
tggcagaacaagagaaaggctgagggaaaaccatatgacaagcccaacattgtcactggt
gccaatgtccaagtttgctgggaaaaattcgctaggtacttcgaagtggaactgaaggaa
gtgaaactgagggatggctattatgtcatggaccctgagaaggcagtggacttggtggat
gagaacaccatttgtgtcgctgcaatcctcggttcaacactcaatggagaatttgaggat
gtcaagctcctgaatgacctactagaaaagaagaacaagcaaacaggttgggatacacca
atccatgtagatgctgcaagcggtggattcattgccccattcttgtaccctgaccttgaa
tgggactttaggctaccactggtgaagagcattaatgtcagcgggcacaaatatggtctt
gtgtatgctggcattggatgggtcatctggaggagcaaggaggacttgcctgaagaactc
atcttccacatcaactatcttggagctgatcaaccaacattcaccctaaacttttccaaa
ggctctagccaagtcattgcgcagtactatcagctaattcgcttgggatttgagggatac
aggaatataatggagaactgtcaagagaatgccatggtgcttaagagaggccttgagagc
actggcaagttcaacattatctcgaaggacaatggtgtacctctagtggcattctcattg
aaagaccggagccggcatgatgagtttgaggtgtcggacttcctgcggaggtttgggtgg
attgtgccggcatacacattgccacctgatgcacagcatattacagtgctgcgtgttgtc
atcagggaggacttcagccgtacgctcgcggagcgacttgtgctcgacattgagaaggtt
ctgcatgagctcgatgcgctgccttccaaggtactaatgccaccagtgatcgatggggtg
aaagagaatgggactgtgatcaagaagggtgcacttgaggtgcagaggtcggtcacagaa
gcatggaagaagtttgtcatggccaagaagaccaatggtgtttgctaa

DBGET integrated database retrieval system