KEGG   Elaeis guineensis (African oil palm): 105056797Help
Entry
105056797         CDS       T03921                                 

Definition
(RefSeq) uncharacterized protein LOC105056797
Organism
egu  Elaeis guineensis (African oil palm)
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH
Motif
Other DBs
NCBI-GeneID: 105056797
NCBI-ProteinID: XP_010937411
LinkDB All DBs
Position
13
AA seq 330 aa AA seqDB search
MGWRGILGFDYGVVQGPLGPDISGPELVAAVANAGGIGILRAPDWEAPEYLRELIQKTRT
LTNKPFGVGIVLAFPHKENIKVVLDERVALLHVSWGEYPRELVSEAHQAGVKVIHQVGCF
EEAEKAKIAGVDAIIVQGREAGGHIIGHDGLMPLLPRVVDLVSDCDIPVIGAGGIVDGRG
YVAALALGAQGVCLGTRFVATVESFAHPSYKQKLVEFDKTEYTNVFGRSRWPGAPHRVLQ
TLFFEDWRHLPVHENEENQPVIGHSIIHGMKKDIRRFAGTVPNATTMGDIDSMVMYAGQG
VGLIREIPPAGEVVKRLVEEAQSIVQQRFS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggttggagagggattcttgggttcgattacggcgtcgtccagggtcccctcggcccc
gacatctctggccccgagctcgtcgccgccgtcgccaatgctggcggcatcgggatcctc
cgtgcccccgactgggaagcacctgaatacttgagggagctcatacaaaaaacaagaacc
ttgacgaacaaaccatttggggttggcattgttctagcattcccacacaaggaaaatata
aaggtcgtattggatgaaagggttgctctattgcatgtttcctggggagaatacccaaga
gagcttgtatccgaagctcatcaagcaggtgtcaaagtcattcaccaagttggatgcttt
gaagaagcagagaaagccaaaattgctggtgtggatgcaattattgttcaaggtcgagag
gctggagggcacattattggccacgatggattgatgccattgttgccaagagtagttgat
ttggtttcagattgtgatatcccagtcattggtgctgggggtattgtagatggtcgtggc
tatgttgctgctttggcccttggtgctcagggtgtctgcctcggaactaggtttgttgct
actgttgagagctttgcacatccttcatacaagcaaaaactagtggaatttgataaaact
gagtacacaaatgtgtttggtcggtcaaggtggcctggtgctccacatcgtgtactgcaa
acactattttttgaagattggaggcatctcccagttcatgaaaatgaggaaaaccagcct
gtcataggtcattcaataattcatggcatgaaaaaagacatacgccgttttgctggtact
gttccaaatgcaacaacaatgggtgatattgatagcatggtcatgtatgctggtcaaggc
gtgggccttatcagggagattccgcctgctggtgaagtggtgaagaggctagttgaggaa
gcacagtccattgttcaacaacgattttcttag

DBGET integrated database retrieval system