KEGG   Elaeis guineensis (African oil palm): 105057698Help
Entry
105057698         CDS       T03921                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:egu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105057698
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     105057698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 105057698
NCBI-ProteinID: XP_010938694
LinkDB All DBs
Position
14
AA seq 152 aa AA seqDB search
MVKAVAVLGGSEGVKGTVYFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPAGHEHGAPEDEIRHAGDLGNVTAGDDGTVNFTIIDSKIPLSGSNSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgctgtacttggtggcagtgagggtgtcaaaggcactgtttacttc
acccaagaaggagatggtccaacaacagtgactggaagcctctctggcctcaaacctggg
cttcatggcttccatgttcatgcccttggtgacactactaatggctgcatgtccactgga
ccacatttcaatcctgctggacatgaacatggggcacctgaagatgagatccgccatgct
ggtgatcttggaaatgtgactgctggtgatgatggtactgttaattttaccattattgac
agcaagattccactgtctggatcaaattcgattattggaagggctgtagtggtccatgct
gatcctgatgatcttggaaaaggtggacacgagctgagcaagagcactggaaatgctggt
ggaagagttgcttgtggcattattggactgcaggcctaa

DBGET integrated database retrieval system