KEGG   Elaeis guineensis (African oil palm): 105057784Help
Entry
105057784         CDS       T03921                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu03030  DNA replication
egu03410  Base excision repair
egu03420  Nucleotide excision repair
egu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:egu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    105057784
   03410 Base excision repair
    105057784
   03420 Nucleotide excision repair
    105057784
   03430 Mismatch repair
    105057784
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egu03032]
    105057784
   03400 DNA repair and recombination proteins [BR:egu03400]
    105057784
Enzymes [BR:egu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105057784
    6.5.1.6  DNA ligase (ATP or NAD+)
     105057784
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     105057784
DNA replication proteins [BR:egu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    105057784
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     105057784
DNA repair and recombination proteins [BR:egu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     105057784
   NER (nucleotide excision repair)
    Other NER factors
     105057784
   MMR (mismatch excision repair)
    Other MMR factors
     105057784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 105057784
NCBI-ProteinID: XP_019710431
LinkDB All DBs
Position
14
AA seq 762 aa AA seqDB search
MLLRAPTLTFFKFLPSPPPFFSFFPFSKPKTLNLSSLLYPSSLLYLSSYRGAAMSARRTV
AEALMDGARAAAARKKAKNVEPPTPSPPSDPSRPLPEPPKNPKXSTGSGGPKEQLDEKKK
TATLELRKKCSDFNPRAAAYWKDGEPVPFSFLVRAWELIGKESGRIAMTEILCNAFRTVI
ATTPGDLLAAVYLTANKIAPPHEGLELGIGEASIIKALAEAYGRKEEHVKKQNSELGDLG
LVAKASRSTQKLMFQPKPLTIDKVFKTLRAIAKESGANSQDKKKNHIKGLLVAATECEPL
YITRLLQSKMRIGLAEKTVLVALGQAAVYSETCPRPPLQTQSPLEEAAKIIKQVYSVLPS
YDKIVPTLLQVGVWKLPEACNFTLGVPVGPMLAKPMKAVSEILDKFQGMEFTCEYKYDGE
RAQIHFMEDGSVEIYSRNAERNTGKFPDVVDSISRFKKDTVKSFVLDCEIVAYDHEKQKI
LPFQVLSTRARKGVIISDIKVRVCTFGFDILYINGQPLLPEQLKVRRQHLYSSFEEVPGV
FQFATAITTNDVEEIQKFLEAALNTSCEGLIIKTLDKDATYEPSKRSNNWLKLKKDYMDS
IGDSLDLVPIAAFHGRGKRTGVYGSFLLACYDEHNEEYQTICNIGTGFSESQLEECSASL
RSKVIPLPKPYYQYADTVNPDVWFEPAEVWEVKAADLSISPVHRAASGIVDPNKGISLRF
PRLLRVRDDKSPEQATTSDQVADMYRAQKISHANNQEEEDDD
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgagagctccaactctcacattcttcaaatttctcccttctcctcctcccttc
ttttccttcttccccttctctaaacctaaaaccctaaacctctcctccctcctatacccc
tcctctctcctctacctctcctcctaccgcggcgccgccatgtccgcccgccggaccgtc
gccgaggccctcatggacggcgcccgcgccgccgccgcccggaagaaggccaagaacgta
gagcctcccaccccatccccgccctcggacccctcccgccctcttccggagccgcccaaa
aaccccaaataatccaccggcagcggcggccccaaggaacaattggacgagaagaagaag
accgccaccctcgagctccggaagaagtgttccgatttcaaccctagggccgccgcttac
tggaaggatggcgagccggtccccttctcgtttcttgtccgtgcctgggagctgatcgga
aaagagtccggccggattgccatgacggagatcctttgcaatgccttccggacggtgatc
gccaccactccaggggatcttcttgccgccgtttacctcacggcaaacaagatcgctccg
ccacatgagggtcttgagcttgggatcggggaagcctccatcattaaggcgctcgctgag
gcttatggtcggaaggaggagcatgtgaagaagcaaaacagcgaattgggtgacttgggt
cttgttgcgaaagcaagtcgttcgactcaaaagttgatgttccagcctaaacctttgacg
atcgacaaggttttcaagacactccgggccattgcgaaggaatctggggcaaatagtcaa
gacaagaaaaagaatcatataaagggacttctggttgcggcaactgaatgtgagcctctg
tatataactcgtcttctgcagtcaaagatgcgaattggtttggcagagaaaactgtcctt
gtagctcttggacaagcagctgtgtattctgaaacatgtccgagaccacctttgcaaact
caatctccccttgaagaggctgcaaaaatcatcaaacaagtatattcggtacttcctagc
tatgataaaattgtgcctactcttcttcaagttggggtgtggaaacttccagaggcatgc
aattttacattaggtgtcccagttggacctatgttagctaaaccaatgaaggctgtgtct
gagatccttgataaattccaaggaatggagtttacctgtgaatataaatatgatggtgag
cgtgcccagatacatttcatggaggatgggtcagtcgagatatacagtcgtaatgcggaa
cggaatactgggaagttcccagatgttgttgattctatctcaagattcaaaaaggatact
gtgaaatcatttgtgctggattgtgaaattgttgcttatgaccatgagaagcagaaaatc
ttaccttttcaggtgctcagcactcgtgctcgtaagggtgtgatcataagtgacataaaa
gtcagagtgtgcacctttggctttgatattctgtatatcaatggccaacctcttcttcca
gagcaactcaaagttcgtagacagcatctttatagttcttttgaggaagtgccaggagta
ttccagtttgcaactgcaattacaacaaatgatgtcgaggaaatacaaaaattccttgag
gcggccttgaacaccagttgtgaaggattgattatcaagacgttggataaagatgccaca
tatgagccctcgaagcggtcaaacaactggctgaagctgaagaaagactacatggacagc
attggtgactcactagatttggtgcctattgcggcattccatggtcgtggaaaacgtaca
ggggtttatggttcgtttcttcttgcttgctatgatgaacacaatgaagaatatcaaacc
atttgtaacataggtacgggattttctgagtcacagcttgaagaatgttctgcaagcctt
cgcagtaaagtgattcctttgccaaagccttattatcagtatgctgatacagtgaatcca
gatgtatggtttgaaccagcagaggtttgggaggtgaaggcagcagatttgagcatcagc
cctgttcatcgtgctgctagtggcatagtggatccaaataagggtatttcgcttcgattt
cctcgtttgttacgtgttcgtgatgacaaaagccctgaacaagcgacaacatccgatcag
gttgctgacatgtatcgtgctcaaaagattagccatgctaacaatcaagaggaagaggat
gatgactaa

DBGET integrated database retrieval system