KEGG   Elaeis guineensis (African oil palm): 105059813Help
Entry
105059813         CDS       T03921                                 

Definition
(RefSeq) probable alpha-glucosidase Os06g0675700
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00052  Galactose metabolism
egu00500  Starch and sucrose metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105059813
   00500 Starch and sucrose metabolism
    105059813
Enzymes [BR:egu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105059813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105059813
NCBI-ProteinID: XP_010941563
LinkDB All DBs
Position
Unknown
AA seq 899 aa AA seqDB search
MGALSADNLLLFFFYFFISFCFSSSSHSQQEPAVGYGYKVQSISVNPSGKSLIAKLQLIQ
KSSIYGPDVQDLNLFASFETKDRLRVGITDSGHQRWEVPRSIIPREPHHLSAHRSMLEDN
QDPSKASQSQPESHVLSFEGSDLLFTLHATTPFTFTITRRSTGDILFDTLPIIVFKDRYL
EISSSLPAGRSSLYGLGEHTKKTFRLVPHDSLTMWNSDIAAANTDVNLYGSHPFYMDVRS
SSSSNITYLPGVTHGVLLLNSNGMDVIYGGSYITYKVIGGILDFYFFAGPSPLSVMDQYT
ELIGRPAPMPYWSFGFHQCRYGYKNVSDLEGVVAGYAKAKIPLEVMWTDIDHMDGYKDFT
LDPINFPADKMKAFVEQLHQNGQKYVVILDPGISVNNTYDTFLRGMKDGIFLKRDGTYYL
GRVWPGPVYFPDFLNPAAAEFWAGEIDIFRKTLPVDGLWIDMNEISNFITSPPLNSLDDP
PYRINNDGVRRPINNLTVPASALHYGNLSEYDVHNLYGFLEARATHDGLMKSTGKRPFVL
SRSTFVGSGKYTAHWTGDNAAKWEDLGYSISSILNSGLFGVPMVGADICGFGGDTTEELC
GRWIQLGAFYPFARDHSEKNSNRRELYVWDSVARSARKALGLRYRLLPYFYTLMYEAHVK
GAPIARPLFFSFPEDVKTYDISKQFLIGKGVMVSPVLNQGSVSVDAYFPKGKWFNLFNHS
QMVSSDFGKYVTLDAPEDAINVHVRGGNILVMQEEAMTVQLARQSGFKLLVVLDEDNNAA
GEVYLDDGEVVEMAGKESQWSLVRFGSVIEDKDVKVRSEVVNATYALNQKLLLEKVVFLG
LELKETPKMATISLNGMEVCCNSKVSARYQTNGRFGVAEIEGLSQLIGEEFELKFKLTN
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgggagccttatccgcagataatctcctccttttcttcttctacttcttcatctctttt
tgtttctcttcttcatcccattctcagcaagaaccagctgttgggtatggctacaaggtc
caatcgatcagtgtcaacccttcagggaagtccctgatcgccaagcttcaacttattcag
aagtcgtcgatctatggaccagatgttcaggacctcaatctcttcgcatcctttgaaacc
aaagatcgcctgcgagtcggaataacggattctggtcaccaaagatgggaagtcccacga
agcatcatcccacgcgagccccatcatctctcggcccatcgatcaatgctcgaagacaac
caagatccatcgaaagcctctcagtctcaaccagaaagccatgttctctccttcgaagga
tccgacctcctctttaccctccatgcaaccactcccttcaccttcaccatcacccgccgc
tccaccggcgacatcctctttgacacgttgcccataattgtcttcaaagaccgatactta
gagatctcttcatcactccctgcagggagatcatccctctatggtcttggggagcatacc
aagaagacattccggctggtaccccatgacagtttaacgatgtggaattctgacatagct
gcagcaaacacagatgtaaatctgtatggttctcacccattctacatggatgtgagatca
tcatcatcatccaatatcacatacctgccaggagtgactcatggcgtgctccttctcaat
agcaatggcatggatgtcatctatggtggatcttacattacttacaaagtgattggagga
attctcgacttctatttctttgcaggtccgtcacctctatcagtcatggatcagtacact
gagctcatcggccggccggcaccgatgccatattggtcctttggattccatcagtgtcgt
tatggctacaagaatgtatcggatcttgaaggcgtcgtagcaggatatgccaaagctaag
atccctctagaagtaatgtggaccgacattgatcacatggatggatacaaggactttaca
cttgatcctatcaactttcctgcagacaagatgaaggcatttgtggaacaacttcaccag
aatggacagaaatatgtggtcatactggacccaggtatcagtgttaataatacatatgat
acattcctaagaggaatgaaagatggcatctttctgaagagagatggaacatattacctt
ggacgagtgtggcctggacctgtctacttccccgacttcctgaacccagctgctgctgaa
ttctgggccggagagatcgatatattccgcaagactcttccggtcgacggcttatggatc
gacatgaatgagatctccaacttcatcacctccccgccgctcaattccctggatgaccct
ccttacaggatcaacaatgatggtgttcgaagacctatcaacaatttaacagttccagct
tctgctcttcactacgggaacctatcagagtatgacgtgcacaacctctatggcttcttg
gaagccagggcaacccatgatggactgatgaagtccacagggaagaggccatttgtactc
agtcgatcgactttcgttggctcagggaagtatacagctcattggaccggtgataatgca
gcaaagtgggaggatctcggctactcaatttcatccatactgaactctggactgtttggt
gttccgatggtcggagcagatatctgcgggtttggcggagacacgaccgaggagctctgt
ggaagatggattcagctaggtgcattctatccctttgcaagggaccactctgaaaaaaac
agcaaccgccgagagctctatgtttgggactctgtcgcccgatcagcaagaaaggcactc
ggcctccgataccgcctgcttccctatttctacaccctgatgtatgaggcacatgtcaaa
ggtgcacctattgcgcgacctctcttcttctcattccctgaagatgtcaaaacctatgat
atcagtaagcagtttctgattggaaaaggtgtgatggtctccccagtattgaatcaagga
tcggtctcggtcgatgcttattttccgaaagggaaatggttcaacctcttcaaccactcg
cagatggtgagcagtgattttgggaagtatgtcacgctggatgcaccagaggatgctata
aacgtgcatgtgaggggagggaacatcttggtaatgcaggaagaggcaatgacagtgcaa
ttggcacggcagagtggattcaagctcctggtggtgctcgatgaggataacaatgcagct
ggggaggtctatttggatgatggagaggtggtggagatggcaggcaaggagagtcagtgg
agtttagtcaggttcggcagtgtgatagaagataaggatgtgaaggtcaggtcggaggtt
gtgaatgctacatatgcgttgaatcagaagttgctgctagagaaggttgtgttcctgggg
ttggagttgaaagaaacacctaaaatggctaccatatctttgaatggaatggaagtatgt
tgtaactcaaaggtgagtgctaggtaccaaacgaatgggagatttggagttgcagaaatt
gaaggcttgtcgcagctcattggcgaggaatttgagttgaaattcaagctcacaaattag

DBGET integrated database retrieval system