KEGG   Elaeis guineensis (African oil palm): 105060729Help
Entry
105060729         CDS       T03921                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00020  Citrate cycle (TCA cycle)
egu00190  Oxidative phosphorylation
egu01100  Metabolic pathways
egu01110  Biosynthesis of secondary metabolites
egu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105060729
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105060729
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105060729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO Lycopene_cycl HI0933_like
Motif
Other DBs
NCBI-GeneID: 105060729
NCBI-ProteinID: XP_010942839
LinkDB All DBs
Position
1
AA seq 634 aa AA seqDB search
MWRSCVSRGLRLLSCKKASIGRQPIRHSPSTPRFLSTNSVGQYTVVDHTYDAVVVGAGGA
GLRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDW
LGDQDAIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACA
ADRTGHALLHSLYGQAMKHNTQFFVEFFALDLLMDGNGTCKGVIALNMEDGTLHRFRAAN
TILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHL
PPDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVHIKGDDPDA
IVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEICKPGEKQKPLEKDAGE
RTIAWLDKLRNSNGSLLTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKAWESFHDVK
IRDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKREDQNWLKHSL
GYWENEKVRLAYRPVHMNTLDDEVESFPPKARVY
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggagctgcgtgtcccgaggccttcgcctcctctcgtgcaagaaggcgtcgatc
ggacgccagccgatccgccactccccgtctacgcccagatttctttccaccaattcggtg
ggacagtacactgttgtggatcatacctatgatgcagttgttgtaggagctgggggtgct
gggcttagagctgccattggactctctgagcatggctttaacacagcttgcattaccaag
ctctttcctactcgctctcatactgttgcagctcagggtggtataaatgcagcccttgga
aatatgactgaagatgactggaggtggcatatgtatgatacagtcaaaggaagtgattgg
ttaggtgatcaggatgctattcagtatatgtgcagagaagcaccaaaagcagttattgag
cttgaaaattatggattaccattttcccgaactgaagatgggaagatctatcaacgtgct
tttggaggtcaaagtttgaactttggaaaaggtggccaggcctatcgttgtgcatgcgct
gctgatcgaactggtcatgcactgcttcactccctttatggtcaagcaatgaagcataac
acccagttctttgtggaattctttgcattggatcttctcatggatggcaatgggacttgc
aagggggtgattgcattgaacatggaggatgggacccttcaccgtttccgtgctgccaac
acaattttggcaactgggggttatggcagggcatacttctctgcaacttcagctcataca
tgtacaggagatggcaatgctatggttgcacgtgctggattgcctctccaggatcttgag
tttgttcagttccacccaactggcatatatggtgctgggtgcctcataactgaaggatct
cgtggagaaggcggtatccttaggaacagtgaaggtgaacgttttatggaacgatatgct
cctactgccaaggatcttgcatcacgagatgttgtttcaagatccatgacaatggaaata
agagaaggtcgtggtgtgggaccactgaaggatcacatctatctgcacttgaatcattta
ccaccagatgttctcaaggaaagacttcctggcatatctgaaacagccgctatttttgct
ggagtggatgtcactaaggagcccatccctgttttgcctacagtgcactataatatgggt
ggaatccccacaaactatcatggggaggtagttcatatcaaaggtgatgatccagatgcc
atagttcctggtctgatggctgctggagaggcagcttgtgcatctgttcatggtgcaaat
cgccttggtgcaaattcccttctagatatagtggttttcggcagagcttgtgctaacagg
gttgcagagatttgcaagccaggagagaaacagaaacctcttgaaaaagatgctggagaa
aggaccattgcctggcttgataaattaagaaactcgaatggttcactgctaacttcaaaa
attcgtctcaacatgcaacgggtgatgcaaaacaatgctgctgtctttcgaactcaagaa
acgctagaagaaggttgtcagttaattgacaaagcatgggagagttttcatgatgtcaaa
attcgtgatcggagtttgatatggaattctgacttaatagaaacaatagagctggaaaat
cttctaataaatgcatgtataactatgcactcagctgaggcaaggaaggagagtagagga
gctcatgctcgtgaagattttacgaaaagagaggatcagaactggttgaaacattcacta
ggatattgggagaatgagaaggttaggctggcatataggcctgtccacatgaataccctg
gatgatgaagttgagtcattcccaccaaaagcacgtgtttattaa

DBGET integrated database retrieval system