KEGG   Elaeis guineensis (African oil palm): 105060892Help
Entry
105060892         CDS       T03921                                 

Definition
(RefSeq) alpha-amylase isozyme 3D isoform X1
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00500  Starch and sucrose metabolism
egu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105060892
Enzymes [BR:egu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     105060892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 105060892
NCBI-ProteinID: XP_010943052
LinkDB All DBs
Position
Unknown
AA seq 426 aa AA seqDB search
MGKLLDPLFLALVLVLSLAPNGAVAQILFQGFNWESWKKEGGWYNFLKGQVSDIANAGVT
HVWLPPPSHSVSEQGYMPGRLYDLNVSKYGNQDELKSLISAFHGKGIKCVADIVINHRCA
DKMDGRGIYCIFEGGTPDDRLDWGPTMICSDDTKYSDGTGHPDTGLGFDAAPDIDHLNLR
VQHELSDWMNWLKSDLGFDGWRLDFAKGYSSDIAKIYVDQTTPSFVVAEIWSSLAYGNDG
KPAYDQNAHRQELVNWVQTVAGPATAFDFTTKGILQAAVQGELWRMRDSNGKASGMLGWW
PEKAVTFIDNHDTGSTQRLWPFPSDKVMQGYVYILTHPGIPSIFYDHLFDWGFKEQISEL
ATIRSRNGIHPGSSLRIIVSDSDLYVAAIDEKIIAKIGPRYDVGKVVPSNFQIVASGNDY
CVWEKR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcttttggatccattgttcttggcactcgtgctggtgctgtctcttgcaccc
aacggggccgttgctcaaatcctttttcagggttttaattgggagtcatggaagaaagaa
gggggatggtataactttctgaagggccaagtatctgatattgccaatgctggggttacg
catgtgtggctccctccaccctcgcattcggtgtcagaacaaggttatatgccaggaagg
ttgtacgatctgaatgtatcgaaatatgggaaccaagacgagctgaagtcactgatcagt
gcattccatggcaaaggaatcaaatgcgttgccgacattgtcatcaatcacagatgtgca
gataaaatggatgggagaggcatatattgtatcttcgaaggtgggacacctgatgaccgc
ctcgactggggcccgaccatgatctgcagtgatgataccaaatactctgatggcaccggt
caccctgacaccggtcttggtttcgatgcggcgcctgacatcgaccacctcaacctaagg
gtccaacatgagctctccgattggatgaattggctcaagagcgaccttggtttcgatgga
tggcggcttgattttgctaaaggatactcatcagacattgccaagatttatgtagatcaa
accacaccaagttttgtggttgcagagatttggagctctttagcttatggaaatgatggc
aagccagcctatgaccaaaatgctcaccgccaagagctagttaattgggttcaaacagtt
gctggtccagcaacagcttttgatttcaccaccaagggaatactacaagcagcagtgcaa
ggagagctgtggaggatgcgtgattccaatggaaaggcatctgggatgcttggatggtgg
ccagagaaggcggtcacattcatcgacaaccatgatactggttcgacgcagaggttatgg
ccttttccttctgataaggtcatgcaaggctatgtttacattctcactcacccagggatc
cccagcattttctatgatcatttgtttgattggggtttcaaggagcagatcagtgagttg
gcaacaatcaggtccaggaatgggattcatccaggtagctcattgcgcatcatagtttcc
gacagtgatctctatgtagcggcaattgacgagaagattattgcaaagatcggaccaaga
tatgatgtcgggaaggttgttccttcgaactttcagattgttgcctctggtaatgactac
tgtgtatgggagaagaggtga

DBGET integrated database retrieval system