KEGG   Elaeis guineensis (African oil palm): 105061136Help
Entry
105061136         CDS       T03921                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00564  Glycerophospholipid metabolism
egu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    105061136
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     105061136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA HI0933_like Lycopene_cycl NAD_binding_8 Pyr_redox_3 FAD_binding_3 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 105061136
NCBI-ProteinID: XP_010943403
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MAASRLKGFRTVLALSGVSIAAAVTVVGPAAAANDHGPAGLETARRRIADPAAAVPPREV
QESALMGTSPISPLDVLVIGGGATGCGVALDAASRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALRERKQVIENAPHLCHSLPCMTPCFDWFEVVYYWMG
LKLYDLVAGRRMLHLSRYYSANESVELFPTLAKKGHKRTLKGTVVYYDGQMNDSRLNVGL
ACTASLLGAAVLNHAEVISFIKDEFGERIIGTRIRDNLSGKEFDAFAKVVVNAAGPFCDS
IRKMANKDAPPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVAFMLPWLGRTVAGTTD
SNTAITMLPEPHEDEIQFILDAICDYLNVQVRRSDVLSAWSGIRPLAIDPSAKNTESISR
DHVVCEDSPGLITITGGKWTTYRSMAEDAVDAAIKSAKLNPTNGCVTDHLQIVGGYGWDP
ASFTVIAQQYVRMKKTHGGKVIPGVMDSAIAKHLSHAYGTMAERVATIAQNENLGKRLAH
GYLFLEAEVAYCARHEYCASAIDFLARRSRLAFLDTDAAGRALPRVIKILADEHRWDKAR
QKLELQKAKEFLETFKSSKNAQFHDGKHTGS
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcgcgattgaagggattccggaccgttttggccctctcaggggtgtcgatc
gctgcggcggtgaccgtcgtcggtccggcggccgccgccaacgaccacgggcccgccggg
ctggagactgcgcggcggcggatcgctgacccggctgccgccgtgccgccgagggaggtg
caggagtcggcgctgatgggcaccagcccgatcagccccctcgacgtcctagtgatcggc
ggcggggccaccggttgcggggtggcgctcgacgccgcgtcccgtgggcttcgggtaggg
cttgtcgagagggaggacttctcgtccgggacctcgtcccgatccaccaagttgatccat
ggaggggtcaggtacttggagaaggcagtgtttaatcttgattatgggcagttgaaactt
gttttccatgcacttagggagcgtaaacaagttattgagaatgcaccacacttatgccat
tctttgccatgcatgacaccatgttttgattggtttgaggttgtgtattactggatggga
ctaaagttatatgatcttgttgctggccgaaggatgctacatttgtcacgttattattct
gcgaatgagtcagtcgaactttttcctactcttgccaaaaagggtcataagagaaccttg
aaaggaacagtggtttattatgatgggcaaatgaatgattctcggctgaatgtaggattg
gcttgcactgcttcattactaggtgcagcagtgcttaaccatgcagaagtaatctccttc
attaaggatgagtttggtgagcggataattggcacacgcatccgtgataacttatcagga
aaagaattcgatgcatttgctaaagttgttgtaaatgcggctggacccttttgcgactcc
ataagaaaaatggctaacaaagatgcaccacccatgatctgtccaagtagtggtgtgcac
atagttttacctgattattattctcctgagggaatgggactgattgttcccaaaactaag
gatgggcgtgtagcgttcatgttgccctggctgggaaggacagttgcagggactacagat
tccaacactgcaatcacaatgctcccagaaccacatgaagatgagatacaatttatattg
gatgccatctgtgattaccttaacgttcaggtaaggcgctcagatgttctttctgcctgg
agtggtattcgtccattggccattgatccgtcagcaaagaacactgagagtatttctaga
gatcatgttgtatgtgaagactctcctggtctaattacaattacaggtggaaagtggacc
acttacagaagcatggctgaagatgcagttgatgcagctataaagtcagccaagttgaac
cctacgaatggctgtgtgaccgaccacctgcaaattgttggtggttatggatgggatcct
gcatcattcactgtaatcgcacagcaatatgtacgcatgaagaagacacatggtgggaag
gttattcctggggtaatggacagtgctattgccaagcatctatctcatgcgtatggtact
atggctgaacgtgtggctacgattgctcagaatgagaatctagggaagcggcttgcacat
ggatatctatttctggaggctgaggttgcatactgtgctcggcatgagtactgtgcatct
gctattgatttccttgccaggaggtctcggcttgcttttcttgacactgatgcagcaggg
cgagcattgccgcgtgttatcaagattttggctgatgaacacaggtgggacaaggctaga
cagaaactagagctgcagaaggctaaagaattcttagaaaccttcaagtcatcaaaaaac
gcacagttccatgatggaaaacatacagggtcatga

DBGET integrated database retrieval system